2EW9 - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF APOWLN5-6

Authors :   S. Ciofi-Baffoni, Structural Proteomics In Europe (Spine)

Date :   02 Nov 05 (Deposition) - 16 May 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (31x)

Keywords :   Copper Trafficking, Ferrodoxin-Like Fold, Structural Genomics, Structural Proteomics In Europe, Spine, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Achila, L. Banci, I. Bertini, J. Bunce, S. Ciofi-Baffoni, D. L. Huffman
Structure Of Human Wilson Protein Domains 5 And 6 And Their Interplay With Domain 4 And The Copper Chaperone Hah1 In Copper Uptake.
Proc. Natl. Acad. Sci. Usa V. 103 5729 2006
PubMed-ID: 16571664 | Reference-DOI: 10.1073/PNAS.0504472103
(for further references see the PDB file header)

Molecule 1 - COPPER-TRANSPORTING ATPASE 2
	Chains	:	A
	EC Number	:	3.6.3.4
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET24D+
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 486-633
	Gene	:	ATP7B, PWD, WC1, WND
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	COPPER PUMP 2, WILSON DISEASE-ASSOCIATED PROTEIN


NMR Structure (31x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2EW9)

(no "Site" information available for 2EW9)

(no "SS Bond" information available for 2EW9)

(no "Cis Peptide Bond" information available for 2EW9)

NMR Structure (17, 17)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_044454	A	486	S	ATP7B_HUMAN	Disease (WD)	---	A	A	2	S
02	UniProt	VAR_000710	L	492	S	ATP7B_HUMAN	Disease (WD)	---	A	L	8	S
03	UniProt	VAR_044455	Y	532	H	ATP7B_HUMAN	Disease (WD)	---	A	Y	48	H
04	UniProt	VAR_058925	V	536	A	ATP7B_HUMAN	Unclassified (WD)	138427376	A	V	52	A
05	UniProt	VAR_076970	P	539	L	ATP7B_HUMAN	Disease (WD)	572122562	A	P	55	L
06	UniProt	VAR_076696	E	541	K	ATP7B_HUMAN	Unclassified (WD)	187046823	A	E	57	K
07	UniProt	VAR_067335	L	549	P	ATP7B_HUMAN	Disease (WD)	---	A	L	65	P
08	UniProt	VAR_000711	N	565	S	ATP7B_HUMAN	Polymorphism	778475094	A	N	81	S
09	UniProt	VAR_044456	G	591	D	ATP7B_HUMAN	Disease (WD)	797045402	A	G	107	D
10	UniProt	VAR_076794	G	591	S	ATP7B_HUMAN	Disease (WD)	---	A	G	107	S
11	UniProt	VAR_076697	V	597	I	ATP7B_HUMAN	Unclassified (WD)	760501309	A	V	113	I
12	UniProt	VAR_044457	A	604	P	ATP7B_HUMAN	Disease (WD)	---	A	A	120	P
13	UniProt	VAR_076732	V	606	G	ATP7B_HUMAN	Unclassified (WD)	---	A	V	122	G
14	UniProt	VAR_076698	G	614	C	ATP7B_HUMAN	Unclassified (WD)	376565432	A	G	130	C
15	UniProt	VAR_009004	R	616	Q	ATP7B_HUMAN	Disease (WD)	752850609	A	R	132	Q
16	UniProt	VAR_023012	R	616	W	ATP7B_HUMAN	Disease (WD)	374172791	A	R	132	W
17	UniProt	VAR_000712	G	626	A	ATP7B_HUMAN	Disease (WD)	587783299	A	G	142	A

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HMA_2	PS50846	Heavy-metal-associated domain profile.	ATP7B_HUMAN	59-125 144-210 258-327 360-426 489-555 565-631	2	- - - - A:5-71 A:81-147
2	HMA_1	PS01047	Heavy-metal-associated domain.	ATP7B_HUMAN	64-93 149-178 263-292 365-394 494-523 570-599	2	- - - - A:10-39 A:86-115

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000242839	1	ENSE00002179667	chr13:52585630-52585423	208	ATP7B_HUMAN	1-17	17	0	-	-
1.5b	ENST00000242839	5b	ENSE00001793840	chr13:52549304-52548071	1234	ATP7B_HUMAN	18-429	412	0	-	-
1.6	ENST00000242839	6	ENSE00001750372	chr13:52544885-52544628	258	ATP7B_HUMAN	429-515	87	1	A:1-31	31
1.7	ENST00000242839	7	ENSE00001626066	chr13:52542743-52542580	164	ATP7B_HUMAN	515-569	55	1	A:31-85	55
1.8a	ENST00000242839	8a	ENSE00001663793	chr13:52539169-52539008	162	ATP7B_HUMAN	570-623	54	1	A:86-139	54
1.9	ENST00000242839	9	ENSE00001778246	chr13:52536049-52535973	77	ATP7B_HUMAN	624-649	26	1	A:140-149	10
1.10	ENST00000242839	10	ENSE00001797943	chr13:52534458-52534284	175	ATP7B_HUMAN	649-707	59	0	-	-
1.11	ENST00000242839	11	ENSE00001661412	chr13:52532680-52532447	234	ATP7B_HUMAN	708-785	78	0	-	-
1.12	ENST00000242839	12	ENSE00001780518	chr13:52531743-52531652	92	ATP7B_HUMAN	786-816	31	0	-	-
1.13	ENST00000242839	13	ENSE00001691729	chr13:52524535-52524408	128	ATP7B_HUMAN	816-859	44	0	-	-
1.14	ENST00000242839	14	ENSE00001628540	chr13:52524297-52524143	155	ATP7B_HUMAN	859-910	52	0	-	-
1.15	ENST00000242839	15	ENSE00001610847	chr13:52523932-52523798	135	ATP7B_HUMAN	911-955	45	0	-	-
1.16b	ENST00000242839	16b	ENSE00001682155	chr13:52520614-52520420	195	ATP7B_HUMAN	956-1020	65	0	-	-
1.17	ENST00000242839	17	ENSE00001721174	chr13:52518427-52518245	183	ATP7B_HUMAN	1021-1081	61	0	-	-
1.18	ENST00000242839	18	ENSE00001706162	chr13:52516690-52516522	169	ATP7B_HUMAN	1082-1138	57	0	-	-
1.19a	ENST00000242839	19a	ENSE00001770820	chr13:52515360-52515217	144	ATP7B_HUMAN	1138-1186	49	0	-	-
1.20	ENST00000242839	20	ENSE00001687534	chr13:52513329-52513187	143	ATP7B_HUMAN	1186-1233	48	0	-	-
1.21	ENST00000242839	21	ENSE00001595712	chr13:52511815-52511612	204	ATP7B_HUMAN	1234-1301	68	0	-	-
1.22	ENST00000242839	22	ENSE00001612752	chr13:52511529-52511412	118	ATP7B_HUMAN	1302-1341	40	0	-	-
1.23	ENST00000242839	23	ENSE00001665491	chr13:52509831-52509729	103	ATP7B_HUMAN	1341-1375	35	0	-	-
1.24b	ENST00000242839	24b	ENSE00001813320	chr13:52509165-52506809	2357	ATP7B_HUMAN	1375-1465	91	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:149
 aligned with ATP7B_HUMAN | P35670 from UniProtKB/Swiss-Prot  Length:1465

    Alignment length:149
                                   494       504       514       524       534       544       554       564       574       584       594       604       614       624         
          ATP7B_HUMAN   485 VAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ 633
               SCOP domains d2ew9a1 A:1-74 automated matches                                          d2ew9a2 A:75-149 automated matches                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeee.....hhhhhhhhhhhh......eeee....eeeeee.....hhhhhhhhhhhhh.eeee.........eeeeeee...hhhhhhhhhhhhhhh....eeeee....eeeee......hhhhhhhhhhhhh.eee... Sec.struct. author
             SAPs(SNPs) (1) -S-----S---------------------------------------H---A--L-K-------P---------------S-------------------------D-----I------P-G-------C-Q---------A------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------S------------------------W----------------- SAPs(SNPs) (2)
                PROSITE (1) ----HMA_2  PDB: A:5-71 UniProt: 489-555                                ---------HMA_2  PDB: A:81-147 UniProt: 565-631                              -- PROSITE (1)
                PROSITE (2) ---------HMA_1  PDB: A:10-39           ----------------------------------------------HMA_1  PDB: A:86-115          ---------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.6  PDB: A:1-31          ------------------------------------------------------Exon 1.8a  PDB: A:86-139 UniProt: 570-623             Exon 1.9   Transcript 1 (1)
           Transcript 1 (2) ------------------------------Exon 1.7  PDB: A:31-85 UniProt: 515-569                ---------------------------------------------------------------- Transcript 1 (2)
                 2ew9 A   1 MAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQ 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: HMA, heavy metal-associated domain (79)

Family: automated matches (20)

Protein domain: automated matches (20)

Human (Homo sapiens) [TaxId: 9606] (10)

1a	d2ew9a1	A:1-74
1b	d2ew9a2	A:75-149

(no "CATH Domain" information available for 2EW9)

(no "Pfam Domain" information available for 2EW9)

NMR Structure(hide GO term definitions)

Chain A (ATP7B_HUMAN | P35670)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0019829	cation-transporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + cation(out) = ADP + phosphate + cation(in).
	GO:0005507	copper ion binding	Interacting selectively and non-covalently with copper (Cu) ions.
	GO:0005375	copper ion transmembrane transporter activity	Catalysis of the transfer of copper (Cu) ions from one side of a membrane to the other.
	GO:0004008	copper-exporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + Cu2+(in) -> ADP + phosphate + Cu2+(out).
	GO:0043682	copper-transporting ATPase activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + Cu2+ = ADP + phosphate + Cu2+, directly driving the transport of the copper ions across a membrane.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006812	cation transport	The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006878	cellular copper ion homeostasis	Any process involved in the maintenance of an internal steady state of copper ions at the level of a cell.
	GO:0006882	cellular zinc ion homeostasis	Any process involved in the maintenance of an internal steady state of zinc ions at the level of a cell.
	GO:0007623	circadian rhythm	Any biological process in an organism that recurs with a regularity of approximately 24 hours.
	GO:0060003	copper ion export	The directed movement of copper ions out of a cell or organelle.
	GO:0015677	copper ion import	The directed movement of copper ions into a cell or organelle.
	GO:0035434	copper ion transmembrane transport	The directed movement of copper cation across a membrane.
	GO:0006825	copper ion transport	The directed movement of copper (Cu) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0015680	intracellular copper ion transport	The directed movement of copper (Cu) ions within a cell.
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007595	lactation	The regulated release of milk from the mammary glands and the period of time that a mother lactates to feed her young.
	GO:0030001	metal ion transport	The directed movement of metal ions, any metal ion with an electric charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0046688	response to copper ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a copper ion stimulus.
	GO:0010043	response to zinc ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
	GO:0051208	sequestering of calcium ion	The process of binding or confining calcium ions such that they are separated from other components of a biological system.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0000139	Golgi membrane	The lipid bilayer surrounding any of the compartments of the Golgi apparatus.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0005923	bicellular tight junction	An occluding cell-cell junction that is composed of a branching network of sealing strands that completely encircles the apical end of each cell in an epithelial sheet; the outer leaflets of the two interacting plasma membranes are seen to be tightly apposed where sealing strands are present. Each sealing strand is composed of a long row of transmembrane adhesion proteins embedded in each of the two interacting plasma membranes.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005770	late endosome	A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005802	trans-Golgi network	The network of interconnected tubular and cisternal structures located within the Golgi apparatus on the side distal to the endoplasmic reticulum, from which secretory vesicles emerge. The trans-Golgi network is important in the later stages of protein secretion where it is thought to play a key role in the sorting and targeting of secreted proteins to the correct destination.
	GO:0032588	trans-Golgi network membrane	The lipid bilayer surrounding any of the compartments that make up the trans-Golgi network.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ew9)

	Sites
(no "Sites" information available for 2ew9)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ew9)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ew9
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ATP7B_HUMAN \| P35670
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.4
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	277900
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ATP7B_HUMAN \| P35670
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ATP7B_HUMAN \| P35670	:	2arf 2koy 2lqb 2n7y 2rop

(no "Related Entries Specified in the PDB File" available for 2EW9)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (17, 17)

PROSITE Motifs (2, 4)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (43, 43)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File