2ENQ - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE C2 DOMAIN FROM HUMAN PI3-KINASE P110 SUBUNIT ALPHA

Authors :   H. Endo, T. Nagashima, M. Yoshida, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   28 Mar 07 (Deposition) - 01 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Pi3-Kinase P110 Subunit Alpha, Phosphatidylinositol-4, 5- Bisphosphate 3-Kinase Catalytic Subunit Alpha Isoform, Pi3K, C2 Type2, Beta Sandwichx, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Endo, T. Nagashima, M. Yoshida, F. Hayashi, S. Yokoyama
Solution Structure Of The C2 Domain From Human Pi3-Kinase P110 Subunit Alpha
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUBUNIT ALPHA ISOFORM
	Chains	:	A
	EC Number	:	2.7.1.153
	Engineered	:	YES
	Expression System Plasmid	:	P060417-17
	Expression System Vector Type	:	PLASMID
	Fragment	:	C2 DOMAIN
	Gene	:	PIK3CA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL FREE PROTEIN SYNTHESIS
	Synonym	:	PI3-KINASE P110 SUBUNIT ALPHA, PTDINS-3- KINASE P110, PI3K


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2ENQ)

(no "Site" information available for 2ENQ)

(no "SS Bond" information available for 2ENQ)

(no "Cis Peptide Bond" information available for 2ENQ)

NMR Structure (10, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_042943	S	332	R	PK3CA_HUMAN	Polymorphism	1051407	A	S	9	R
02	UniProt	VAR_026169	Y	343	C	PK3CA_HUMAN	Unclassified	---	A	Y	20	C
03	UniProt	VAR_069789	V	356	I	PK3CA_HUMAN	Disease (CWS5)	587777793	A	V	33	I
04	UniProt	VAR_069252	G	364	R	PK3CA_HUMAN	Disease (MCAP)	---	A	G	41	R
05	UniProt	VAR_069253	E	365	K	PK3CA_HUMAN	Disease (MCAP)	---	A	E	42	K
06	UniProt	VAR_069254	C	378	Y	PK3CA_HUMAN	Disease (MCAP)	397514565	A	C	55	Y
07	UniProt	VAR_069790	R	382	K	PK3CA_HUMAN	Disease (CWS5)	587777794	A	R	59	K
08	UniProt	VAR_026170	I	391	M	PK3CA_HUMAN	Polymorphism	2230461	A	I	68	M
09	UniProt	VAR_026171	C	420	R	PK3CA_HUMAN	Disease (CLOVE)	121913272	A	C	97	R
10	UniProt	VAR_026172	E	453	Q	PK3CA_HUMAN	Disease (CRC)	---	A	E	130	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PI3K_C2	PS51547	Phosphatidylinositol 3-kinase C2 (PI3K C2) domain profile.	PK3CA_HUMAN	330-487	1	A:8-158

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000263967	2	ENSE00001493081	chr3:178866311-178866391	81	PK3CA_HUMAN	-	0	0	-	-
1.4b	ENST00000263967	4b	ENSE00001139995	chr3:178916538-178916965	428	PK3CA_HUMAN	1-118	118	0	-	-
1.5	ENST00000263967	5	ENSE00000997375	chr3:178917478-178917687	210	PK3CA_HUMAN	118-188	71	0	-	-
1.6	ENST00000263967	6	ENSE00001077693	chr3:178919078-178919328	251	PK3CA_HUMAN	188-271	84	0	-	-
1.7	ENST00000263967	7	ENSE00001077692	chr3:178921332-178921577	246	PK3CA_HUMAN	272-353	82	1	A:1-30 (gaps)	34
1.8	ENST00000263967	8	ENSE00001077694	chr3:178922291-178922376	86	PK3CA_HUMAN	354-382	29	1	A:31-59	29
1.9	ENST00000263967	9	ENSE00001077691	chr3:178927383-178927488	106	PK3CA_HUMAN	382-417	36	1	A:59-94	36
1.10	ENST00000263967	10	ENSE00001128470	chr3:178927974-178928126	153	PK3CA_HUMAN	418-468	51	1	A:95-145	51
1.11	ENST00000263967	11	ENSE00001128465	chr3:178928219-178928353	135	PK3CA_HUMAN	469-513	45	1	A:146-158	13
1.12	ENST00000263967	12	ENSE00001077674	chr3:178935998-178936122	125	PK3CA_HUMAN	514-555	42	0	-	-
1.13	ENST00000263967	13	ENSE00000826291	chr3:178936984-178937065	82	PK3CA_HUMAN	555-582	28	0	-	-
1.14b	ENST00000263967	14b	ENSE00000826292	chr3:178937359-178937523	165	PK3CA_HUMAN	583-637	55	0	-	-
1.15	ENST00000263967	15	ENSE00000826293	chr3:178937737-178937840	104	PK3CA_HUMAN	638-672	35	0	-	-
1.16	ENST00000263967	16	ENSE00000826294	chr3:178938774-178938945	172	PK3CA_HUMAN	672-729	58	0	-	-
1.17	ENST00000263967	17	ENSE00000826295	chr3:178941869-178941975	107	PK3CA_HUMAN	730-765	36	0	-	-
1.18	ENST00000263967	18	ENSE00000826296	chr3:178942488-178942609	122	PK3CA_HUMAN	765-806	42	0	-	-
1.19b	ENST00000263967	19b	ENSE00000826297	chr3:178943750-178943828	79	PK3CA_HUMAN	806-832	27	0	-	-
1.20	ENST00000263967	20	ENSE00000826298	chr3:178947060-178947230	171	PK3CA_HUMAN	832-889	58	0	-	-
1.21	ENST00000263967	21	ENSE00000826299	chr3:178947792-178947909	118	PK3CA_HUMAN	889-928	40	0	-	-
1.22	ENST00000263967	22	ENSE00000826300	chr3:178948013-178948164	152	PK3CA_HUMAN	929-979	51	0	-	-
1.23	ENST00000263967	23	ENSE00001139987	chr3:178951882-178957881	6000	PK3CA_HUMAN	979-1068	90	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:158
 aligned with PK3CA_HUMAN | P42336 from UniProtKB/Swiss-Prot  Length:1068

    Alignment length:162
                                   329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479  
          PK3CA_HUMAN   320 GETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFS 481
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......----..eeeeeeeeee..........eeeeeeeeee..ee....ee............eeeeeeee.hhh...eeeeeeeeeeee.....eeeeeeeeeee.............eeee.ee........................eeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------R----------C------------I-------RK------------Y---K--------M----------------------------R--------------------------------Q---------------------------- SAPs(SNPs)
                    PROSITE ----------PI3K_C2  PDB: A:8-158 UniProt: 330-487                                                                                                                   PROSITE
           Transcript 1 (1) Exon 1.7  PDB: A:1-30 (gaps)      Exon 1.8  PDB: A:31-59       -----------------------------------Exon 1.10  PDB: A:95-145 UniProt: 418-468          Exon 1.11     Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------Exon 1.9  PDB: A:59-94              ---------------------------------------------------------------- Transcript 1 (2)
                 2enq A   1 GSSGSSG----NSALRIKILCATYVNVNIRDIDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFS 158
                                  |  - |      16        26        36        46        56        66        76        86        96       106       116       126       136       146       156  
                                  7    8

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2ENQ)

(no "CATH Domain" information available for 2ENQ)

(no "Pfam Domain" information available for 2ENQ)

NMR Structure(hide GO term definitions)

Chain A (PK3CA_HUMAN | P42336)

molecular function
	GO:0016303	1-phosphatidylinositol-3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+).
	GO:0035005	1-phosphatidylinositol-4-phosphate 3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4-phosphate + ATP = 1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate + ADP + 2 H(+).
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0043560	insulin receptor substrate binding	Interacting selectively and non-covalently with any of the insulin receptor substrate (IRS) proteins, adaptor proteins that bind to the transphosphorylated insulin and insulin-like growth factor receptors, are themselves phosphorylated and in turn recruit SH2 domain-containing signaling molecules to form a productive signaling complex.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0035004	phosphatidylinositol 3-kinase activity	Catalysis of the reaction: ATP + a phosphatidylinositol = ADP + a phosphatidylinositol 3-phosphate. This reaction is the addition of a phosphate group to phosphatidylinositol or one of its phosphorylated derivatives at the 3' position of the inositol ring.
	GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030295	protein kinase activator activity	Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0038128	ERBB2 signaling pathway	A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	An Fc-gamma receptor signaling pathway that contributes to the endocytic engulfment of external particulate material by phagocytes.
	GO:0031295	T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment T cell activation.
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0032147	activation of protein kinase activity	Any process that initiates the activity of an inactive protein kinase.
	GO:0060612	adipose tissue development	The process whose specific outcome is the progression of adipose tissue over time, from its formation to the mature structure. Adipose tissue is specialized tissue that is used to store fat.
	GO:0001525	angiogenesis	Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0071333	cellular response to glucose stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0043542	endothelial cell migration	The orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
	GO:0097009	energy homeostasis	Any process involved in the balance between food intake (energy input) and energy expenditure.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0006006	glucose metabolic process	The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
	GO:0044029	hypomethylation of CpG island	An decrease in the epigenetic methylation of cytosine and adenosine residues in a CpG island in DNA. CpG islands are genomic regions that contain a high frequency of the CG dinucleotide and are often associated with the transcription start site of genes.
	GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	The series of molecular signals generated as a consequence of the insulin receptor binding to its physiological ligand, where the signal is passed on via the phosphatidylinositol 3-kinase cascade.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0001889	liver development	The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
	GO:2000811	negative regulation of anoikis	Any process that stops, prevents or reduces the frequency, rate or extent of anoikis.
	GO:2000270	negative regulation of fibroblast apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of fibroblast apoptotic process.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0006909	phagocytosis	An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
	GO:0006661	phosphatidylinositol biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol, any glycophospholipid in which the sn-glycerol 3-phosphate residue is esterified to the 1-hydroxyl group of 1D-myo-inositol.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphatidylinositol-3-phosphate, a phosphatidylinositol monophosphate carrying the phosphate group at the 3-position.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0030168	platelet activation	A series of progressive, overlapping events triggered by exposure of the platelets to subendothelial tissue. These events include shape change, adhesiveness, aggregation, and release reactions. When carried through to completion, these events lead to the formation of a stable hemostatic plug.
	GO:0098779	positive regulation of macromitophagy in response to mitochondrial depolarization	The macromitophagy process that is triggered by a detection of the loss of mitochondrial membrane potential.
	GO:0033138	positive regulation of peptidyl-serine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0043491	protein kinase B signaling	A series of reactions, mediated by the intracellular serine/threonine kinase protein kinase B (also called AKT), which occurs as a result of a single trigger reaction or compound.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0043457	regulation of cellular respiration	Any process that modulates the frequency, rate or extent of cellular respiration, the enzymatic release of energy from organic compounds.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:2000653	regulation of genetic imprinting	Any process that modulates the frequency, rate or extent of genetic imprinting.
	GO:0040014	regulation of multicellular organism growth	Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0048010	vascular endothelial growth factor receptor signaling pathway	Any series of molecular signals initiated by the binding of an extracellular ligand to a vascular endothelial growth factor receptor (VEGFR) located on the surface of the receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0001944	vasculature development	The process whose specific outcome is the progression of the vasculature over time, from its formation to the mature structure. The vasculature is an interconnected tubular multi-tissue structure that contains fluid that is actively transported around the organism.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0005942	phosphatidylinositol 3-kinase complex	A protein complex capable of phosphatidylinositol 3-kinase activity and containing subunits of any phosphatidylinositol 3-kinase (PI3K) enzyme. These complexes are divided in three classes (called I, II and III) that differ for their presence across taxonomic groups and for the type of their constituents. Catalytic subunits of phosphatidylinositol 3-kinase enzymes are present in all 3 classes; regulatory subunits of phosphatidylinositol 3-kinase enzymes are present in classes I and III; adaptor proteins have been observed in class II complexes and may be present in other classes too.
	GO:0005943	phosphatidylinositol 3-kinase complex, class IA	A class I phosphatidylinositol 3-kinase complex that possesses 1-phosphatidylinositol-4-phosphate 3-kinase activity; comprises a catalytic class IA phosphoinositide 3-kinase (PI3K) subunit and an associated SH2 domain-containing regulatory subunit that is a member of a family of related proteins often called p85 proteins. Through the interaction with the SH2-containing adaptor subunits, Class IA PI3K catalytic subunits are linked to tyrosine kinase signaling pathways.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2enq)

	Sites
(no "Sites" information available for 2enq)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2enq)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2enq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PK3CA_HUMAN \| P42336
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.153
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	114500
		Disease Information	:	OMIM
	602501
		Disease Information	:	OMIM
	612918
		Disease Information	:	OMIM
	615108
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PK3CA_HUMAN \| P42336
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 2ENQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (10, 10)

PROSITE Motifs (1, 1)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (57, 57)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File