Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HYPOTHETICAL CONSERVED PROTEIN (GK1048) FROM GEOBACILLUS KAUSTOPHILUS
 
Authors :  P. H. Rehse, S. Yokoyama, Riken Structural Genomics/Proteomics In (Rsgi)
Date :  28 Mar 07  (Deposition) - 02 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Cbs Domains, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. H. Rehse, S. Yokoyama
Hypothetical Conserved Protein (Gk1048) From Geobacillus Kaustophilus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL CONSERVED PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System StrainBL21-CODONPLUS(DE3)-RIL
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificGEOBACILLUS KAUSTOPHILUS
    Organism Taxid235909
    StrainHTA426

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EMQ)

(-) Sites  (0, 0)

(no "Site" information available for 2EMQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EMQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EMQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EMQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2EMQ)

(-) Exons   (0, 0)

(no "Exon" information available for 2EMQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:135
 aligned with Q5L147_GEOKA | Q5L147 from UniProtKB/TrEMBL  Length:157

    Alignment length:135
                                    19        29        39        49        59        69        79        89        99       109       119       129       139     
         Q5L147_GEOKA    10 QMTVKPFLIPADKVAHVQPGNYLDHALLVLTKTGYSAIPVLDTSYKLHGLISMTMMMDAILGLERIEFERLETMKVEEVMNRNIPRLRLDDSLMKAVGLIVNHPFVCVENDDGYFAGIFTRREVLKQLNKQLHRP 144
               SCOP domains d2emqa_ A: automated matches                                                                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........ee.hhh.......hhhhhhhhhhhh....eeee.....eeeeehhhhhhhhh......hhhhhhh.hhhhh......eee...hhhhhhhhhhhh.eeeee.....eeeeeehhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2emq A  10 QMTVKPFLIPADKVAHVQPGNYLDHALLVLTKTGYSAIPVLDTSYKLHGLISMTMMMDAILGLERIEFERLETMKVEEVMNRNIPRLRLDDSLMKAVGLIVNHPFVCVENDDGYFAGIFTRREVLKQLNKQLHRP 144
                                    19        29        39        49        59        69        79        89        99       109       119       129       139     

Chain B from PDB  Type:PROTEIN  Length:133
 aligned with Q5L147_GEOKA | Q5L147 from UniProtKB/TrEMBL  Length:157

    Alignment length:133
                                    18        28        38        48        58        68        78        88        98       108       118       128       138   
         Q5L147_GEOKA     9 MQMTVKPFLIPADKVAHVQPGNYLDHALLVLTKTGYSAIPVLDTSYKLHGLISMTMMMDAILGLERIEFERLETMKVEEVMNRNIPRLRLDDSLMKAVGLIVNHPFVCVENDDGYFAGIFTRREVLKQLNKQL 141
               SCOP domains d2emqb_ B: automated matches                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........ee.hhh.......hhhhhhhhhh......eeee.....eeeeehhhhhhhhh......hhhhhhh.hhhhh......eee...hhhhhhhhhhhh.eeeee.....eeeeeehhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2emq B   9 MQMTVKPFLIPADKVAHVQPGNYLDHALLVLTKTGYSAIPVLDTSYKLHGLISMTMMMDAILGLERIEFERLETMKVEEVMNRNIPRLRLDDSLMKAVGLIVNHPFVCVENDDGYFAGIFTRREVLKQLNKQL 141
                                    18        28        38        48        58        68        78        88        98       108       118       128       138   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EMQ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EMQ)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2EMQ)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2emq)
 
  Sites
(no "Sites" information available for 2emq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2emq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2emq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5L147_GEOKA | Q5L147
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5L147_GEOKA | Q5L147
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2EMQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EMQ)