|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EME) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EME) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EME) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EME) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZN473_HUMAN | Q8WTR7 from UniProtKB/Swiss-Prot Length:871 Alignment length:168 631 641 651 661 671 681 691 701 711 721 731 741 751 761 771 781 ZN473_HUMAN 622 GEQGKAISSASLIKLQSFHTKEHPFKCNECGKTFSHSAHLSKHQLIHAGENPFKCSKCDRVFTQRNYLVQHERTHARKKPLVCNECGKTFRQSSCLSKHQRIHSGEKPYVCDYCGKAFGLSAELVRHQRIHTGEKPYVCQECGKAFTQSSCLSIHRRVHTGEKPYRCG 789 SCOP domains -------------------------------------------------------------------------------------------------------d2emea1 A:8-35 ------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------------------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZI PROSITE Transcript 1 Exon 1.5a PDB: A:1-46 (gaps) UniProt: 76-871 [INCOMPLETE] Transcript 1 2eme A 1 GSSG---SSG---------------------------------------------------------------------------------------------SGEKPYVCDYCGKAFGLSAELVRHQRIHTGEKP-----------------------SG--PS-SG 46 | | 7 - - - - - - - - - | 14 24 34 | - - 41| || | 4 5 7 8 40 41| 43| | 42 44 | 45
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EME) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EME) |
Gene Ontology (12, 12)|
NMR Structure(hide GO term definitions) Chain A (ZN473_HUMAN | Q8WTR7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|