|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (0, 0)| (no "Site" information available for 2EM3) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EM3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EM3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EM3) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with ZFP28_HUMAN | Q8NHY6 from UniProtKB/Swiss-Prot Length:868 Alignment length:181 554 564 574 584 594 604 614 624 634 644 654 664 674 684 694 704 714 724 ZFP28_HUMAN 545 GSSLTVHQRIHTGEKPYECDVCRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHLRIHTGEKPFECAECGKSFSISSQLATHQRIHTGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCMECGKAFGDNSSCTQHQRLHTG 725 SCOP domains -----------------------------------------------------------------------------------------------d2em3a1 A:8-35 ---------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ZINC_FINGER-------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -- PROSITE Transcript 1 Exon 1.8 PDB: A:1-46 (gaps) UniProt: 300-868 [INCOMPLETE] Transcript 1 2em3 A 1 GSS---------GS-------------------------SG------------------------------------------------------TGEKPYECKVCSKAFTQKAHLAQHQKTHTGEKP-----------------------SG--P-------------SS---------G 46 | - || - - 6| - - - - - | 12 22 32 | - - - || | - 44| -| 3 4| 6| 8 40 41| 43 44| 46 5 7 42 45
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EM3) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EM3) |
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (ZFP28_HUMAN | Q8NHY6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|