|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 8)| Asymmetric/Biological Unit (2, 8) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2EHS) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EHS) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EHS) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2EHS) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:75 aligned with ACP_AQUAE | O67611 from UniProtKB/Swiss-Prot Length:78 Alignment length:75 11 21 31 41 51 61 71 ACP_AQUAE 2 SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV 76 SCOP domains d2ehsa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------PHOSPHOPANTETHEI------------------------------ PROSITE Transcript --------------------------------------------------------------------------- Transcript 2ehs A 1 SLEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKIQTVGDVINYLKEKV 75 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EHS) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EHS) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ACP_AQUAE | O67611)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|