|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2EHF) |
Sites (0, 0)| (no "Site" information available for 2EHF) |
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EHF) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EHF) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2EHF) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:73 aligned with CSMD1_HUMAN | Q96PZ7 from UniProtKB/Swiss-Prot Length:3565 Alignment length:108 496 506 516 526 536 546 556 566 576 586 CSMD1_HUMAN 487 GSSVPDLIVSMSNQMWLHLQSDDSIGSPGFKAVYQEIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSG 594 SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE CUB PDB: - UniProt: 412-523 --SUSHI PDB: A:12-67 UniProt: 526-583 -CUB PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2ehf A 1 GSS----------------------GSSG------EIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGNKPSCS-------GPSSG 73 | - - | |- | 12 22 32 42 52 62 | - | 3 4 7 8 68 69
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2EHF) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EHF) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EHF) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (CSMD1_HUMAN | Q96PZ7)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|