Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PH1819 PROTEIN FROM PYROCOCCUS HORIKOSHII OT3
 
Authors :  B. Bagautdinov, N. Kunishima, Riken Structural Genomics/Proteomi Initiative (Rsgi)
Date :  16 Feb 07  (Deposition) - 21 Aug 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Dimer, Hypothetical Protein, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Bagautdinov, N. Kunishima
Crystal Structure Of Ph1819 Protein From Pyrococcus Horikoshii Ot3
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PH1819
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET11A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PH1819
    Organism Scientific: PYROCOCCUS HORIKOSHII
    Organism Taxid: 53953

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EEN)

(-) Sites  (0, 0)

(no "Site" information available for 2EEN)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:39 -B:39

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2EEN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EEN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2EEN)

(-) Exons   (0, 0)

(no "Exon" information available for 2EEN)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:177
 aligned with O59483_PYRHO | O59483 from UniProtKB/TrEMBL  Length:183

    Alignment length:177
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       
         O59483_PYRHO     2 YEVELKGYANDEIFEKVRETFEFMRKEIHEDIYYQHPCRDFSKTDEALRIRIKRFNGHNEVFLTYKGPKIDEKSKTRLEIEVEIQEDVDKYFELLDRLGFKEVLKVVKTREKYYVEKGVTITLDEVEGLGKFIEIETLVKEKDEIPEAVEKLEKILRELGVEKFERRSYLELLLEKR 178
               SCOP domains d2eena_ A: automated matches                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.hhhhhhhhhh..eeeeeeeeeeeeee....hhhhhh.eeeeeeeee..eeeeeeeeeeee.......eeeeeeee..hhhhhhhhhhhh..eeeeeeeeeeeeeeee..eeeeeeee...eeeeeeeee..hhhhhhhhhhhhhhhhhhh........hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2een A   2 YEVELKGYANDEIFEKVRETFEFMRKEIHEDIYYQHPCRDFSKTDEALRIRIKRFNGHNEVFLTYKGPKIDEKSKTRLEIEVEIQEDVDKYFELLDRLGFKEVLKVVKTREKYYVEKGVTITLDEVEGLGKFIEIETLVKEKDEIPEAVEKLEKILRELGVEKFERRSYLELLLEKR 178
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       


Chain B from PDB  Type:PROTEIN  Length:163
 aligned with O59483_PYRHO | O59483 from UniProtKB/TrEMBL  Length:183

    Alignment length:180
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182
         O59483_PYRHO     3 EVELKGYANDEIFEKVRETFEFMRKEIHEDIYYQHPCRDFSKTDEALRIRIKRFNGHNEVFLTYKGPKIDEKSKTRLEIEVEIQEDVDKYFELLDRLGFKEVLKVVKTREKYYVEKGVTITLDEVEGLGKFIEIETLVKEKDEIPEAVEKLEKILRELGVEKFERRSYLELLLEKRTELN 182
               SCOP domains d2eenb_ B: automated matches                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee.hhhhhhhhhhhheeeeeeeeeeeeee....hhhhhh.eeeeeeeee..eeeeeeeee..---------.eeeeee..hhhhhhhhhhhh..eeeeeeeeeeeeeeee..eeeeeeee...eeeeeeee..--------hhhhhhhhhhhh........hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2een B   3 EVELKGYANDEIFEKVRETFEFMRKEIHEDIYYQHPCRDFSKTDEALRIRIKRFNGHNEVFLTYKGP---------LEIEVEIQEDVDKYFELLDRLGFKEVLKVVKTREKYYVEKGVTITLDEVEGLGKFIEIETLV--------AVEKLEKILRELGVEKFERRSYLELLLEKRTELN 182
                                    12        22        32        42        52        62      |  -      | 82        92       102       112       122       132       | -      |152       162       172       182
                                                                                             69        79                                                          140      149
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2EEN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EEN)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2EEN)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2een)
 
  Sites
(no "Sites" information available for 2een)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2een)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2een
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O59483_PYRHO | O59483
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O59483_PYRHO | O59483
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2EEN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2EEN)