2E9K - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE CH DOMAIN FROM HUMAN MICAL-2

Authors :   T. Tomizawa, N. Tochio, S. Koshiba, S. Watanabe, T. Harada, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   25 Jan 07 (Deposition) - 31 Jul 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Ch Domain, All-Alpha, Actin Binding, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, N. Tochio, S. Koshiba, S. Watanabe, T. Harada, T. Kigawa, S. Yokoyama
Solution Structure Of The Ch Domain From Human Mical-2
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - PROTEIN MICAL-2
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P060522-24
	Expression System Vector Type	:	PLASMID
	Fragment	:	CH DOMAIN
	Gene	:	MICAL2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2E9K)

(no "Site" information available for 2E9K)

(no "SS Bond" information available for 2E9K)

(no "Cis Peptide Bond" information available for 2E9K)

(no "SAP(SNP)/Variant" information available for 2E9K)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CH	PS50021	Calponin homology domain profile.	MICA2_HUMAN	516-619	1	A:8-111

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5a	ENST00000256194	5a	ENSE00001194865	chr11:12132138-12132273	136	MICA2_HUMAN	-	0	0	-	-
1.8c	ENST00000256194	8c	ENSE00001194859	chr11:12159937-12160011	75	MICA2_HUMAN	-	0	0	-	-
1.11c	ENST00000256194	11c	ENSE00002151286	chr11:12183626-12183966	341	MICA2_HUMAN	1-88	88	0	-	-
1.14e	ENST00000256194	14e	ENSE00001100552	chr11:12225797-12226004	208	MICA2_HUMAN	89-158	70	0	-	-
1.15b	ENST00000256194	15b	ENSE00001100537	chr11:12229570-12229686	117	MICA2_HUMAN	158-197	40	0	-	-
1.16	ENST00000256194	16	ENSE00001100571	chr11:12231044-12231145	102	MICA2_HUMAN	197-231	35	0	-	-
1.17	ENST00000256194	17	ENSE00001642628	chr11:12234802-12234957	156	MICA2_HUMAN	231-283	53	0	-	-
1.18a	ENST00000256194	18a	ENSE00001100576	chr11:12237766-12237866	101	MICA2_HUMAN	283-316	34	0	-	-
1.19	ENST00000256194	19	ENSE00000988112	chr11:12241748-12242005	258	MICA2_HUMAN	317-402	86	0	-	-
1.20	ENST00000256194	20	ENSE00000988113	chr11:12243191-12243306	116	MICA2_HUMAN	403-441	39	0	-	-
1.21	ENST00000256194	21	ENSE00001194830	chr11:12244164-12244290	127	MICA2_HUMAN	441-483	43	0	-	-
1.22	ENST00000256194	22	ENSE00001194820	chr11:12244958-12245048	91	MICA2_HUMAN	484-514	31	1	A:1-6 (gaps)	13
1.23b	ENST00000256194	23b	ENSE00001194814	chr11:12246220-12246367	148	MICA2_HUMAN	514-563	50	1	A:6-55	50
1.25a	ENST00000256194	25a	ENSE00001100549	chr11:12247718-12247917	200	MICA2_HUMAN	563-630	68	1	A:55-121	67
1.26b	ENST00000256194	26b	ENSE00001100591	chr11:12248572-12248678	107	MICA2_HUMAN	630-665	36	0	-	-
1.27	ENST00000256194	27	ENSE00001100547	chr11:12257724-12257792	69	MICA2_HUMAN	666-688	23	0	-	-
1.28a	ENST00000256194	28a	ENSE00001100555	chr11:12260983-12261132	150	MICA2_HUMAN	689-738	50	0	-	-
1.29	ENST00000256194	29	ENSE00001100535	chr11:12262587-12262709	123	MICA2_HUMAN	739-779	41	0	-	-
1.30b	ENST00000256194	30b	ENSE00001100588	chr11:12263761-12263979	219	MICA2_HUMAN	780-852	73	0	-	-
1.31	ENST00000256194	31	ENSE00001100558	chr11:12264218-12264319	102	MICA2_HUMAN	853-886	34	0	-	-
1.34b	ENST00000256194	34b	ENSE00001194768	chr11:12265534-12265659	126	MICA2_HUMAN	887-928	42	0	-	-
1.35	ENST00000256194	35	ENSE00001264396	chr11:12270731-12270793	63	MICA2_HUMAN	929-949	21	0	-	-
1.37c	ENST00000256194	37c	ENSE00001194764	chr11:12277190-12277297	108	MICA2_HUMAN	950-985	36	0	-	-
1.37f	ENST00000256194	37f	ENSE00001100583	chr11:12278332-12278518	187	MICA2_HUMAN	986-1048	63	0	-	-
1.38	ENST00000256194	38	ENSE00001194760	chr11:12280015-12280103	89	MICA2_HUMAN	1048-1077	30	0	-	-
1.39b	ENST00000256194	39b	ENSE00001264665	chr11:12281342-12281444	103	MICA2_HUMAN	1078-1112	35	0	-	-
1.39g	ENST00000256194	39g	ENSE00001264561	chr11:12284027-12284084	58	MICA2_HUMAN	1112-1124	13	0	-	-
1.39l	ENST00000256194	39l	ENSE00002140635	chr11:12285107-12285332	226	MICA2_HUMAN	-	0	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:121
 aligned with MICA2_HUMAN | O94851 from UniProtKB/Swiss-Prot  Length:1124

    Alignment length:128
                                   511       521       531       541       551       561       571       581       591       601       611       621        
          MICA2_HUMAN   502 GSVRRSVNLSRKESDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPV 629
               SCOP domains d2       e9ka_ A: automated matches                                                                                              SCOP domains
               CATH domains ----------------2e9kA01 A:10-114 Actin-binding Protein, T-fimbrin; domain 1                                              ------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..-------........hhhhhhhhhhhhh..........hhhhh.hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------CH  PDB: A:8-111 UniProt: 516-619                                                                       ---------- PROSITE
           Transcript 1 (1) Exon 1.22    ------------------------------------------------Exon 1.25a  PDB: A:55-121 UniProt: 563-630 [INCOMPLETE]             Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.23b  PDB: A:6-55 UniProt: 514-563          ------------------------------------------------------------------ Transcript 1 (2)
                 2e9k A   1 GS-------SGSSGDIRPSKLLTWCQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMASAQEPDKLSMVMYLSKFYELFRGTPLRPV 121
                             |       3        13        23        33        43        53        63        73        83        93       103       113        
                             2       3

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: CH domain-like (55)

Superfamily: Calponin-homology domain, CH-domain (53)

Family: automated matches (25)

Protein domain: automated matches (25)

Human (Homo sapiens) [TaxId: 9606] (23)

d2e9ka_

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Actin-binding Protein, T-fimbrin; domain 1 (51)

Homologous Superfamily: Actin-binding Protein, T-fimbrin; domain 1 (51)

Human (Homo sapiens) (39)

2e9kA01

A:10-114

(no "Pfam Domain" information available for 2E9K)

NMR Structure(hide GO term definitions)

Chain A (MICA2_HUMAN | O94851)

molecular function
	GO:0071949	FAD binding	Interacting selectively and non-covalently with the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
	GO:0043914	NADPH:sulfur oxidoreductase activity	Catalysis of the reaction: NADPH + H+ + sulfur = hydrogen sulfide + NADP+.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from NADH or NADPH and one other donor, and one atom of oxygen is incorporated into one donor.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0030042	actin filament depolymerization	Disassembly of actin filaments by the removal of actin monomers from a filament.
	GO:0007010	cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0001947	heart looping	The tube morphogenesis process in which the primitive heart tube loops asymmetrically. This looping brings the primitive heart chambers into alignment preceding their future integration. Heart looping begins with dextral-looping and ends when the main regional divisions of the mature heart and primordium of the great arterial trunks become established preceeding septation.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0010735	positive regulation of transcription via serum response element binding	Any process that increases the frequency, rate or extent of the specifically regulated synthesis of RNA from DNA encoding a specific set of genes as a result of a transcription factor interacting with a serum response element (SRE). A serum response element is a short sequence with dyad symmetry found in the promoters of some of the cellular immediate-early genes, regulated by serum.
	GO:0019417	sulfur oxidation	The chemical reactions and pathways resulting the addition of oxygen to elemental sulfur.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2e9k)

	Sites
(no "Sites" information available for 2e9k)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2e9k)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2e9k
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MICA2_HUMAN \| O94851
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MICA2_HUMAN \| O94851
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2E9K)

(no "Related Entries Specified in the PDB File" available for 2E9K)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File