2E50 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF SET/TAF-1BETA/INHAT

Authors :   S. Muto, M. Senda, T. Senda, M. Horikoshi

Date :   18 Dec 06 (Deposition) - 20 Feb 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,P,Q
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: P,Q  (1x)

Keywords :   Histone Chaperone, Inhat, Set, Pp2Ai, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Muto, M. Senda, Y. Akai, L. Sato, T. Suzuki, R. Nagai, T. Senda, M. Horikoshi
Relationship Between The Structure Of Set/Taf-Ibeta/Inhat And Its Histone Chaperone Activity
Proc. Natl. Acad. Sci. Usa V. 104 4285 2007
PubMed-ID: 17360516 | Reference-DOI: 10.1073/PNAS.0603762104
(for further references see the PDB file header)

Molecule 1 - PROTEIN SET
	Chains	:	A, B, P, Q
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET14B
	Expression System Strain	:	BL21(DE3) PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	SET/TAF-1BETA(RESIDUES 1-225)
	Gene	:	SET
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SET/TAF-1BETA, PHOSPHATASE 2A INHIBITOR I2PP2A, I-2PP2A, TEMPLATE-ACTIVATING FACTOR I, TAF-I, HLA-DR ASSOCIATED PROTEIN II, PHAPII, INHIBITOR OF GRANZYME A-ACTIVATED DNASE, IGAAD

		1	2	3	4
Asymmetric Unit	:	A	B	P	Q
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			P	Q

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	TRE	4	Ligand/Ion	TREHALOSE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	TRE	2	Ligand/Ion	TREHALOSE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	TRE	2	Ligand/Ion	TREHALOSE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:11 , ASN A:61 , ARG A:64 , GLN A:65 , PHE A:68 , GLU A:114 , TRP A:213 , HOH A:228 , HOH A:229 , HOH A:237 , HOH A:241 , HOH A:243 , HOH A:244 , HOH A:246	BINDING SITE FOR RESIDUE TRE A 226
2	AC2	SOFTWARE	SER A:2 , ALA A:5 , ALA A:6 , ASN A:46 , ALA A:49 , ILE A:53 , ARG B:64 , PHE B:68 , GLU B:114 , LYS B:209 , ASP B:210 , TRP B:213 , PRO B:214 , HOH B:229 , HOH B:242 , HOH B:249 , HOH B:250 , HOH B:256	BINDING SITE FOR RESIDUE TRE B 226
3	AC3	SOFTWARE	LYS P:11 , ASN P:61 , ARG P:64 , GLN P:65 , PHE P:68 , GLU P:114 , TRP P:213 , HOH P:227 , HOH P:230 , HOH P:235 , HOH P:236 , HOH P:237 , HOH P:239	BINDING SITE FOR RESIDUE TRE P 226
4	AC4	SOFTWARE	SER P:2 , ALA P:5 , ALA P:6 , ASN P:46 , ALA P:49 , SER P:50 , ILE P:53 , ARG Q:64 , PHE Q:68 , GLU Q:114 , LYS Q:209 , ASP Q:210 , TRP Q:213 , PRO Q:214 , HOH Q:237 , HOH Q:244 , HOH Q:248 , HOH Q:253	BINDING SITE FOR RESIDUE TRE Q 226

(no "SS Bond" information available for 2E50)

(no "Cis Peptide Bond" information available for 2E50)

(no "SAP(SNP)/Variant" information available for 2E50)

(no "PROSITE Motif" information available for 2E50)

Asymmetric Unit (7, 28)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000372692	2a	ENSE00001696428	chr9:131445934-131446286	353	SET_HUMAN	1-38	38	4	A:1-25 (gaps) B:24-25 P:1-25 (gaps) Q:24-25	38 2 38 2
1.8b	ENST00000372692	8b	ENSE00000807004	chr9:131453449-131453506	58	SET_HUMAN	38-57	20	4	A:25-44 B:25-44 P:25-44 Q:25-44	20 20 20 20
1.9b	ENST00000372692	9b	ENSE00000807005	chr9:131454137-131454279	143	SET_HUMAN	57-105	49	4	A:44-92 B:44-92 P:44-92 Q:44-92	49 49 49 49
1.10c	ENST00000372692	10c	ENSE00000807006	chr9:131454941-131455044	104	SET_HUMAN	105-139	35	4	A:92-126 B:92-126 P:92-126 Q:92-126	35 35 35 35
1.11c	ENST00000372692	11c	ENSE00000807007	chr9:131455147-131455260	114	SET_HUMAN	140-177	38	4	A:127-164 (gaps) B:127-164 (gaps) P:127-164 (gaps) Q:127-160 (gaps)	38 38 38 34
1.12	ENST00000372692	12	ENSE00000807008	chr9:131455917-131456087	171	SET_HUMAN	178-234	57	4	A:165-221 (gaps) B:165-221 (gaps) P:165-221 (gaps) Q:189-221 (gaps)	57 57 57 33
1.13b	ENST00000372692	13b	ENSE00001052379	chr9:131456175-131456321	147	SET_HUMAN	235-283	49	4	A:222-222 B:222-223 P:222-222 Q:222-223	1 2 1 2
1.14f	ENST00000372692	14f	ENSE00001894304	chr9:131456920-131458679	1760	SET_HUMAN	284-290	7	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:182
 aligned with SET_HUMAN | Q01105 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:235
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
            SET_HUMAN     1 MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 235
               SCOP domains d2  e50a1 A:1           -222      Protein SET                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hh--hhhhhhhhh-----------hh..-----..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhh..eeeeeeee.......eeeeeee.........eeeeee.-------..ee...........----------------------hhhhhh------hhhhhhhhhhh....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:1-25 (gaps)         ------------------------------------------------------------------Exon 1.10c  PDB: A:92-126          Exon 1.11c  PDB: A:127-164 (gaps)     Exon 1.12  PDB: A:165-221 (gaps) UniProt: 178-234        1 Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.8b           ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------------------------------------------Exon 1.9b  PDB: A:44-92 UniProt: 57-105          ---------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 2e50 A   1 MS--AQAAKVSKK-----------ELNS-----DETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFH-------SSKSTEIKWKSGKDM----------------------FFTWFT------ADELGEVIKDDIWPNPLQYYLV 222
                             |  |    8  |      -    |  | -   |    27        37        47        57        67        77        87        97       107       117       127       137      |  -    |  157        |-         -         - |    |  -   |   207       217     
                             2  3      11          12 15    21                                                                                                                        144     152           166                    189  194    201

Chain B from PDB  Type:PROTEIN  Length:167
 aligned with SET_HUMAN | Q01105 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:200
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236
            SET_HUMAN    37 GEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVP 236
               SCOP domains d2e50b_ B: Protein SET                                                                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhh..eeeeeeee......eeeeeeee.........eeeeeee.------.eee...........----------------------hhhhhh-----.hhhhhhhhhhh....hhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.------------------------------------------------------------------Exon 1.10c  PDB: B:92-126          Exon 1.11c  PDB: B:127-164 (gaps)     Exon 1.12  PDB: B:165-221 (gaps) UniProt: 178-234        1. Transcript 1 (1)
           Transcript 1 (2) -Exon 1.8b           ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------Exon 1.9b  PDB: B:44-92 UniProt: 57-105          ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 2e50 B  24 SEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHM------SSKSTEIKWKSGKDM----------------------FFTWFT-----GADELGEVIKDDIWPNPLQYYLVP 223
                                    33        43        53        63        73        83        93       103       113       123       133       143 |     153       163  |      -         -     | 193|     |203       213       223
                                                                                                                                                   145    152           166                    189  194   200

Chain P from PDB  Type:PROTEIN  Length:186
 aligned with SET_HUMAN | Q01105 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:235
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230     
            SET_HUMAN     1 MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 235
               SCOP domains d2e50p_     P: Prote   in SE         T                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhh----hhhhhh...---hhhhh---------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhh.eeeeeeee.......eeeeeee.........eeeeee.-------..ee............---------------------hhhhhh-----.hhhhhhhhhhh....hhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: P:1-25 (gaps)         ------------------------------------------------------------------Exon 1.10c  PDB: P:92-126          Exon 1.11c  PDB: P:127-164 (gaps)     Exon 1.12  PDB: P:165-221 (gaps) UniProt: 178-234        1 Transcript 1 (1)
           Transcript 1 (2) -------------------------------------Exon 1.8b           ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------------------------------------------Exon 1.9b  PDB: P:44-92 UniProt: 57-105          ---------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 2e50 P   1 MSAQAAK----VSKKELNSN---ADETS---------EKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFH-------SSKSTEIKWKSGKDMT---------------------FFTWFT-----GADELGEVIKDDIWPNPLQYYLV 222
                                  |  - |      16   |   | -       |27        37        47        57        67        77        87        97       107       117       127       137      |  -    |  157       167         -         - |    |  -  |    207       217     
                                  7    8      16  20  24        25                                                                                                                    144     152            167                   189  194   200

Chain Q from PDB  Type:PROTEIN  Length:159
 aligned with SET_HUMAN | Q01105 from UniProtKB/Swiss-Prot  Length:290

    Alignment length:200
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236
            SET_HUMAN    37 GEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVP 236
               SCOP domains d2e50q_ Q: Protein SET                                                                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhhhh..eeeeeeee.......eeeeeee.........eeeeee.-------..ee.....----------------------------hhhhhh------hhhhhhhhhhh....hhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.------------------------------------------------------------------Exon 1.10c  PDB: Q:92-126          Exon 1.11c  PDB: Q:127-160 (gaps)     Exon 1.12  PDB: Q:189-221 (gaps) UniProt: 178-234        1. Transcript 1 (1)
           Transcript 1 (2) -Exon 1.8b           ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) --------------------Exon 1.9b  PDB: Q:44-92 UniProt: 57-105          ----------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (3)
                 2e50 Q  24 SEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEAMHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFH-------SSKSTEIKW----------------------------FFTWFT------ADELGEVIKDDIWPNPLQYYLVP 223
                                    33        43        53        63        73        83        93       103       113       123       133       143|      153      |  -         -         -     | 193|      203       213       223
                                                                                                                                                  144     152     160                          189  194    201

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: NAP-like (4)

Superfamily: NAP-like (4)

Family: NAP-like (3)

Protein domain: Protein SET (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d2e50a1	A:1-222
1b	d2e50b_	B:
1c	d2e50p_	P:
1d	d2e50q_	Q:

(no "CATH Domain" information available for 2E50)

(no "Pfam Domain" information available for 2E50)

Asymmetric Unit(hide GO term definitions)

Chain A,B,P,Q (SET_HUMAN | Q01105)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004864	protein phosphatase inhibitor activity	Stops, prevents or reduces the activity of a protein phosphatase, an enzyme that hydrolyzes phosphate groups from phosphorylated proteins.
biological process
	GO:0006260	DNA replication	The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
	GO:0043086	negative regulation of catalytic activity	Any process that stops or reduces the activity of an enzyme.
	GO:0035067	negative regulation of histone acetylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of an acetyl group to a histone protein.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006913	nucleocytoplasmic transport	The directed movement of molecules between the nucleus and the cytoplasm.
	GO:0006334	nucleosome assembly	The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0006337	nucleosome disassembly	The controlled breakdown of nucleosomes, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0043488	regulation of mRNA stability	Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		TRE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2e50)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2e50
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SET_HUMAN \| Q01105
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SET_HUMAN \| Q01105
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2E50)

(no "Related Entries Specified in the PDB File" available for 2E50)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 28)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File