2DZF - JenaLib

Theoretical Model (Jmol Viewer)

Title :   SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE PRECURSOR (IPO-3) (CD150 ANTIGEN) (CDW150)(SLAM).

Authors :   P. Bhattacharya, T. Ganeshan

Date :   28 Sep 06 (Deposition) - 24 Oct 06 (Release) - 24 Oct 06 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : _

Keywords :   Glycoprotein; Host-Virus Interaction; Immunoglobulin Domain; Membrane; Phosphorylation; Polymorphism; Receptor; Repeat; Signal; Transmembrane (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Bhattacharya, T. Ganeshan
Signaling Lymphocytic Activation Molecule Precursor (Ipo-3) (Cd150 Antigen) (Cdw150)(Slam)
Journal Not Decided Yet V. 0 0 2006
PubMed: search
(for further references see the PDB file header)

Molecule 1 - SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE PRECURSOR (IPO-3) (CD150 ANTIGEN) (CDW150) (SLAM)
	Chains	:	_
	EC Number	:	not defined
	Fragment	:	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE PRECURSOR (IPO-3) (CD150)(SLAM)
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Other Details	:	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE PRECURSOR (IPO-3) (CD150 ANTIGEN) (CDW150) (SLAM) OF HOMO SAPIENS
	Strain	:	HOMO SAPIENS


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2DZF)

(no "Site" information available for 2DZF)

(no "SS Bond" information available for 2DZF)

(no "Cis Peptide Bond" information available for 2DZF)

Theoretical Model (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_021924	F	11	L	SLAF1_HUMAN	Polymorphism	2295612	_	F	11	L
2	UniProt	VAR_035524	L	81	F	SLAF1_HUMAN	Unclassified	---	_	L	81	F
3	UniProt	VAR_021925	P	333	T	SLAF1_HUMAN	Polymorphism	3796504	_	P	333	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2DZF)

Theoretical Model (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000302035	1a	ENSE00001850818	chr1:160617085-160616660	426	SLAF1_HUMAN	1-26	26	1	_:1-26	26
1.2c	ENST00000302035	2c	ENSE00001166217	chr1:160607319-160606981	339	SLAF1_HUMAN	26-139	114	1	_:26-139	114
1.3	ENST00000302035	3	ENSE00001166212	chr1:160604687-160604403	285	SLAF1_HUMAN	139-234	96	1	_:139-234	96
1.4	ENST00000302035	4	ENSE00001166202	chr1:160593975-160593886	90	SLAF1_HUMAN	234-264	31	1	_:234-264	31
1.5	ENST00000302035	5	ENSE00001166196	chr1:160589639-160589566	74	SLAF1_HUMAN	264-288	25	1	_:264-288	25
1.7	ENST00000302035	7	ENSE00001166189	chr1:160582370-160582278	93	SLAF1_HUMAN	289-319	31	1	_:289-319	31
1.8b	ENST00000302035	8b	ENSE00001820545	chr1:160580588-160577890	2699	SLAF1_HUMAN	320-335	16	1	_:320-335	16

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain _ from PDB  Type:PROTEIN  Length:335
 aligned with SLAF1_HUMAN | Q13291 from UniProtKB/Swiss-Prot  Length:335

    Alignment length:335
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330     
          SLAF1_HUMAN     1 MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES 335
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................................hhhhhhh....eeee...................................hhhhhhhhhhhhhhh.eeee............hhhhhh..........hhhhhhhhhhhhhhhhh......hhhhh..hhhhhh............hhhhh.......................ee.....ee.......hhhhh.....hhhhhh.....hhhhhhhhhhhhhhhhhh..........hhhhhhhhhh..hhhhhhh..hhhhhh.................................. Sec.struct. author
                 SAPs(SNPs) ----------L---------------------------------------------------------------------F-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T-- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: -         ----------------------------------------------------------------------------------------------------------------Exon 1.3  PDB: - UniProt: 139-234                                                               -----------------------------Exon 1.5  PDB: -         Exon 1.7  PDB: -               Exon 1.8b  PDB:  Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.2c  PDB: - UniProt: 26-139                                                                                 ----------------------------------------------------------------------------------------------Exon 1.4  PDB: -               ----------------------------------------------------------------------- Transcript 1 (2)
                 2dzf _   1 MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES 335
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2DZF)

(no "CATH Domain" information available for 2DZF)

(no "Pfam Domain" information available for 2DZF)

Theoretical Model(hide GO term definitions)

Chain (SLAF1_HUMAN | Q13291)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0004888	transmembrane signaling receptor activity	Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0035744	T-helper 1 cell cytokine production	Any process that contributes to cytokine production by a T-helper 1 cell.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0046649	lymphocyte activation	A change in morphology and behavior of a lymphocyte resulting from exposure to a specific antigen, mitogen, cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0002277	myeloid dendritic cell activation involved in immune response	The change in morphology and behavior of a myeloid dendritic cell resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
	GO:0001779	natural killer cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a natural killer cell.
	GO:0001787	natural killer cell proliferation	The expansion of a natural killer cell population by cell division.
	GO:2000349	negative regulation of CD40 signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of signaling via the CD40 signaling pathway.
	GO:0002725	negative regulation of T cell cytokine production	Any process that stops, prevents, or reduces the frequency, rate, or extent of T cell cytokine production.
	GO:1902714	negative regulation of interferon-gamma secretion	Any process that stops, prevents or reduces the frequency, rate or extent of interferon-gamma secretion.
	GO:0032695	negative regulation of interleukin-12 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-12 production.
	GO:0032715	negative regulation of interleukin-6 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-6 production.
	GO:0032720	negative regulation of tumor necrosis factor production	Any process that stops, prevents, or reduces the frequency, rate, or extent of tumor necrosis factor production.
	GO:0006909	phagocytosis	An endocytosis process that results in the engulfment of external particulate material by phagocytes. The particles are initially contained within phagocytic vacuoles (phagosomes), which then fuse with primary lysosomes to effect digestion of the particles.
	GO:0070374	positive regulation of ERK1 and ERK2 cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
	GO:0046330	positive regulation of JNK cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the JNK cascade.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:1902715	positive regulation of interferon-gamma secretion	Any process that activates or increases the frequency, rate or extent of interferon-gamma secretion.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
	GO:0031338	regulation of vesicle fusion	Any process that modulates the frequency, rate or extent of vesicle fusion.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0009897	external side of plasma membrane	The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045335	phagocytic vesicle	A membrane-bounded intracellular vesicle that arises from the ingestion of particulate material by phagocytosis.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2dzf)

	Sites
(no "Sites" information available for 2dzf)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2dzf)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2dzf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SLAF1_HUMAN \| Q13291
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	notdefined
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SLAF1_HUMAN \| Q13291
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SLAF1_HUMAN \| Q13291	:	1d4t 1d4w 1i3z 1ka6 1ka7 1m27 2ie9 2ifl 2ig5

(no "Related Entries Specified in the PDB File" available for 2DZF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (0, 0)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (39, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File