|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2DSM) |
(no "Site" information available for 2DSM) |
(no "SS Bond" information available for 2DSM) |
(no "Cis Peptide Bond" information available for 2DSM) |
(no "SAP(SNP)/Variant" information available for 2DSM) |
(no "PROSITE Motif" information available for 2DSM) |
(no "Exon" information available for 2DSM) |
NMR StructureChain A from PDB Type:PROTEIN Length:72 aligned with YQAI_BACSU | P45906 from UniProtKB/Swiss-Prot Length:64 Alignment length:72 64 10 20 30 40 50 60 | - YQAI_BACSU 1 MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQ-------- - SCOP domains d2dsma1 A:1-64 Hypothetical protein YqaI -------- SCOP domains CATH domains 2dsmA00 A:1-72 Yqai domain CATH domains Pfam domains ------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------ Transcript 2dsm A 1 MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQLEHHHHHH 72 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:72 aligned with YQAI_BACSU | P45906 from UniProtKB/Swiss-Prot Length:64 Alignment length:72 64 10 20 30 40 50 60 | - YQAI_BACSU 1 MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQ-------- - SCOP domains d2dsmb_ B: Hypothetical protein YqaI SCOP domains CATH domains 2dsmB00 B:1-72 Yqai domain CATH domains Pfam domains ------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------ Transcript 2dsm B 1 MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILRENLERYLREQLGFEFKNAQLEHHHHHH 72 10 20 30 40 50 60 70
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 2DSM) |
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2DSM)
|
|
|
|
|
|
|