|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2DNZ) |
Sites (0, 0)| (no "Site" information available for 2DNZ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2DNZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2DNZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2DNZ) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (3, 3)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:95 aligned with RBM23_HUMAN | Q86U06 from UniProtKB/Swiss-Prot Length:439 Alignment length:108 267 277 287 297 307 317 327 337 347 357 RBM23_HUMAN 258 GNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGG 365 SCOP domains d2dnza_ A: RNA binding protein 23 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -----RRM PDB: A:231-307 UniProt: 263-341 ------------------------ PROSITE Transcript 1 Exon 1.9 PDB: A:224-254 Exon 1.10 Exon 1.12 PDB: A:277-318 (gaps) UniProt: 311-376 Transcript 1 2dnz A 224 GSSGSSGLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGS-------------GPSSG 318 233 243 253 263 273 283 293 303 313 - | 313 314
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2DNZ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2DNZ) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (RBM23_HUMAN | Q86U06)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|