|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2DNM) |
Sites (0, 0)| (no "Site" information available for 2DNM) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2DNM) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2DNM) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2DNM) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2DNM) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:103 aligned with SRSF8_HUMAN | Q9BRL6 from UniProtKB/Swiss-Prot Length:282 Alignment length:111 10 20 30 40 50 60 70 80 90 100 110 SRSF8_HUMAN 1 MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRG 111 SCOP domains d2dnma_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------RRM PDB: A:14-92 UniProt: 14-92 ------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------- Transcript 2dnm A 1 GSSGSSGPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLS--------GPSSG 103 10 20 30 40 50 60 70 80 90 | - |102 98 99
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2DNM) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2DNM) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (SRSF8_HUMAN | Q9BRL6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|