2DNH - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF RNA BINDING DOMAIN IN BRUNO-LIKE 5 RNA BINDING PROTEIN

Authors :   K. Tsuda, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   26 Apr 06 (Deposition) - 26 Oct 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Rrm Domain, Rbd, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Tsuda, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama
Solution Structure Of Rna Binding Domain In Bruno-Like 5 Rna Binding Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - BRUNO-LIKE 5, RNA BINDING PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	CELL FREE SYNTHESIS
	Expression System Plasmid	:	P050725-22
	Expression System Vector Type	:	PLASMID
	Fragment	:	RNA RECOGNITION MOTIF
	Gene	:	BRUNOL5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2DNH)

(no "Site" information available for 2DNH)

(no "SS Bond" information available for 2DNH)

(no "Cis Peptide Bond" information available for 2DNH)

(no "SAP(SNP)/Variant" information available for 2DNH)

NMR Structure (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RRM	PS50102	Eukaryotic RNA Recognition Motif (RRM) profile.	CELF5_HUMAN	45-126 134-214 400-478	2	A:126-126 A:134-214 -

NMR Structure (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000292672	1a	ENSE00000859555	chr19:3224701-3224996	296	CELF5_HUMAN	1-87	87	1	A:119-123	5
1.2	ENST00000292672	2	ENSE00000859558	chr19:3250983-3251065	83	CELF5_HUMAN	87-114	28	0	-	-
1.3	ENST00000292672	3	ENSE00000859559	chr19:3273870-3273921	52	CELF5_HUMAN	115-132	18	1	A:124-132	9
1.4	ENST00000292672	4	ENSE00000859561	chr19:3275854-3275982	129	CELF5_HUMAN	132-175	44	1	A:132-175	44
1.5	ENST00000292672	5	ENSE00001741997	chr19:3278029-3278108	80	CELF5_HUMAN	175-201	27	1	A:175-201	27
1.6	ENST00000292672	6	ENSE00001210748	chr19:3281197-3281343	147	CELF5_HUMAN	202-250	49	1	A:202-217	16
1.7	ENST00000292672	7	ENSE00001056275	chr19:3282124-3282265	142	CELF5_HUMAN	251-298	48	1	A:218-223 (gaps)	37
1.8b	ENST00000292672	8b	ENSE00001056278	chr19:3282350-3282496	147	CELF5_HUMAN	298-347	50	1	A:223-223	1
1.9	ENST00000292672	9	ENSE00001711305	chr19:3284900-3284962	63	CELF5_HUMAN	347-368	22	0	-	-
1.10	ENST00000292672	10	ENSE00001783118	chr19:3285940-3286023	84	CELF5_HUMAN	368-396	29	0	-	-
1.11a	ENST00000292672	11a	ENSE00001056280	chr19:3290229-3290372	144	CELF5_HUMAN	396-444	49	0	-	-
1.12	ENST00000292672	12	ENSE00001056276	chr19:3293317-3293484	168	CELF5_HUMAN	444-485	42	0	-	-
1.13	ENST00000292672	13	ENSE00001357967	chr19:3296756-3297071	316	CELF5_HUMAN	-	0	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:105
 aligned with CELF5_HUMAN | Q8N6W0 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:274
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294    
          CELF5_HUMAN    25 GSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASG 298
               SCOP domains d2dnh                                                                                              a_ A: automated matches                                                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....----------------------------------------------------------------------------------------------...........eeeee......hhhhhhhhhh....eeeeeeee.....eeeeeeeee.hhhhhhhhhhhhh............eeee......--------------------------------------------..-------------------------------.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------RRM  PDB: A:126-126 UniProt: 45-126                                               -------RRM  PDB: A:134-214 UniProt: 134-214                                             ------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:119-123 UniProt: 1-87 [INCOMPLETE]           ---------------------------Exon 1.3          ------------------------------------------Exon 1.5  PDB: A:175-201   Exon 1.6  PDB: A:202-217 UniProt: 202-250        Exon 1.7  PDB: A:218-223 (gaps) UniProt: 251-298 Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------Exon 1.2  PDB: -            -----------------Exon 1.4  PDB: A:132-175 UniProt: 132-175   --------------------------------------------------------------------------------------------------------------------------1 Transcript 1 (2)
                 2dnh A 119 GSSGS----------------------------------------------------------------------------------------------SGSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKE--------------------------------------------SG-------------------------------PSSG 223
                                |    -         -         -         -         -         -         -         -         -       124       134       144       154       164       174       184       194       204       214  |      -         -         -         -       ||-         -         -         -|   
                              123                                                                                            124                                                                                          217                                          218|                             220   
                                                                                                                                                                                                                                                                        219

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Ferredoxin-like (1795)

Superfamily: RNA-binding domain, RBD (289)

Family: automated matches (67)

Protein domain: automated matches (67)

Human (Homo sapiens) [TaxId: 9606] (56)

d2dnha_

(no "CATH Domain" information available for 2DNH)

(no "Pfam Domain" information available for 2DNH)

NMR Structure(hide GO term definitions)

Chain A (CELF5_HUMAN | Q8N6W0)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2dnh)

	Sites
(no "Sites" information available for 2dnh)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2dnh)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2dnh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CELF5_HUMAN \| Q8N6W0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CELF5_HUMAN \| Q8N6W0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2DNH)

(no "Related Entries Specified in the PDB File" available for 2DNH)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File