|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2DLK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2DLK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2DLK) |
PROSITE Motifs (1, 3)
NMR Structure (1, 3)
|
||||||||||||||||||||||||
Exons (5, 5)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:79 aligned with ZN692_HUMAN | Q9BU19 from UniProtKB/Swiss-Prot Length:519 Alignment length:111 302 312 322 332 342 352 362 372 382 392 402 ZN692_HUMAN 293 ASTGSQAQSAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSN 403 SCOP domains -----------------------------------d2dlka1 A:8-37 d2dlka2 A:38-73 ---------- SCOP domains CATH domains ------------------------------------------------------------------2dlkA02 A:39-64 ------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C PROSITE Transcript 1 (1) 1.-------------------------Exon 1.6b PDB: A:8-26 Exon 1.7b PDB: A:27-65 ------------------ Transcript 1 (1) Transcript 1 (2) -Exon 1.5j PDB: A:2-7 ----------------------------------------------------------------Exon 1.9 Transcript 1 (2) 2dlk A 1 GSSGSSG----------------------------MPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFSCPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFSG----PSSG 79 | - - - | 12 22 32 42 52 62 72 | |78 7 8 75 76
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2DLK) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (ZN692_HUMAN | Q9BU19)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|