Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE NOVEL IDENTIFIED UBIQUITIN-LIKE DOMAIN IN THE HUMAN HYPOTHETICAL PROTEIN FLJ35834
 
Authors :  C. Zhao, T. Kigawa, K. Saito, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  14 Dec 05  (Deposition) - 14 Jun 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Hypothetical Protein Flj35834, Ubiquitin-Like Domain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Zhao, T. Kigawa, K. Saito, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Novel Identified Ubiquitin-Like Domain In The Human Hypothetical Protein Flj35834
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FLJ35834 PROTEIN
    Chains: A
    Engineered: YES
    Expression System: CELL FREE SYNTHESIS
    Expression System Plasmid: P050125-04
    Expression System Vector Type: PLASMID
    Fragment: UBIQUITIN-LIKE DOMAIN
    Gene: FLJ35834
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: CELL-FREE PROTEIN SYNTHESIS

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2DAF)

(-) Sites  (0, 0)

(no "Site" information available for 2DAF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2DAF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2DAF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_030332V126MIQUB_HUMANPolymorphism10255061AV11M
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.IQUB_HUMAN131-200  1A:16-85

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003246981bENSE00001286128chr7:123174718-123174546173IQUB_HUMAN-00--
1.3ENST000003246983ENSE00002194685chr7:123152398-123151998401IQUB_HUMAN1-1331331A:1-1818
1.4ENST000003246984ENSE00001286125chr7:123150089-123149955135IQUB_HUMAN133-178461A:18-6346
1.5aENST000003246985aENSE00001286118chr7:123143417-123143256162IQUB_HUMAN178-232551A:63-11654
1.5dENST000003246985dENSE00001286154chr7:123143170-123142998173IQUB_HUMAN232-289581A:117-1182
1.5eENST000003246985eENSE00001086532chr7:123142806-123142651156IQUB_HUMAN290-341520--
1.6ENST000003246986ENSE00001086534chr7:123136960-123136750211IQUB_HUMAN342-412710--
1.7ENST000003246987ENSE00001086531chr7:123120024-123119849176IQUB_HUMAN412-470590--
1.8ENST000003246988ENSE00001086533chr7:123109438-123109268171IQUB_HUMAN471-527570--
1.9ENST000003246989ENSE00001286137chr7:123105063-123104887177IQUB_HUMAN528-586590--
1.11bENST0000032469811bENSE00001286135chr7:123101659-123101411249IQUB_HUMAN587-669830--
1.12ENST0000032469812ENSE00001286132chr7:123097620-123097435186IQUB_HUMAN670-731620--
1.13cENST0000032469813cENSE00001922373chr7:123092979-123092459521IQUB_HUMAN732-791600--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:118
 aligned with IQUB_HUMAN | Q8NA54 from UniProtKB/Swiss-Prot  Length:791

    Alignment length:147
                                   125       135       145       155       165       175       185       195       205       215       225       235       245       255       
           IQUB_HUMAN   116 KSVKESLQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGGFRHKVTG 262
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeee.....eeeeee....hhhhhhhhhhhhhh.....eeeee..eee....hhhhhh.....eeeeeeee...........................-----------------------------.. Sec.struct. author
                 SAPs(SNPs) ----------M---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------UBIQUITIN_2  PDB: A:16-85 UniProt: 131-200                            -------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3          --------------------------------------------Exon 1.5a  PDB: A:63-116 UniProt: 178-232 [INCOMPLETE] ------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.4  PDB: A:18-63 UniProt: 133-178       -----------------------------------------------------Exon 1.5d  PDB: A:117-118       Transcript 1 (2)
                 2daf A   1 GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPS-----------------------------SG 118
                                    10        20        30        40        50        60        70        80        90       100       110     |   -         -         -     | 
                                                                                                                                             116                           117
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2DAF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2DAF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2DAF)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (IQUB_HUMAN | Q8NA54)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030030    cell projection organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a prolongation or process extending from a cell, e.g. a flagellum or axon.
    GO:0060271    cilium assembly    The assembly of a cilium, a specialized eukaryotic organelle that consists of a filiform extrusion of the cell surface. Each cilium is bounded by an extrusion of the cytoplasmic membrane, and contains a regular longitudinal array of microtubules, anchored basally in a centriole.
    GO:0007224    smoothened signaling pathway    A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
cellular component
    GO:0001669    acrosomal vesicle    A structure in the head of a spermatozoon that contains acid hydrolases, and is concerned with the breakdown of the outer membrane of the ovum during fertilization. It lies just beneath the plasma membrane and is derived from the lysosome.
    GO:0031514    motile cilium    A cilium which may have a variable arrangement of axonemal microtubules and also contains molecular motors. It may beat with a whip-like pattern that promotes cell motility or transport of fluids and other cells across a cell surface, such as on epithelial cells that line the lumenal ducts of various tissues; or they may display a distinct twirling motion that directs fluid flow asymmetrically across the cellular surface to affect asymmetric body plan organization. Motile cilia can be found in single as well as multiple copies per cell.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2daf)
 
  Sites
(no "Sites" information available for 2daf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2daf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2daf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IQUB_HUMAN | Q8NA54
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IQUB_HUMAN | Q8NA54
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2DAF)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2DAF)