2D87 - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE CH DOMAIN FROM HUMAN SMOOTHELIN SPLICE ISOFORM L2

Authors :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   02 Dec 05 (Deposition) - 02 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   All Alpha, Calponin Homology Domain, Actin Binding, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Structural Protein, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tomizawa, T. Kigawa, S. Koshiba, M. Inoue, S. Yokoyama
Solution Structure Of The Ch Domain From Human Smoothelin Splice Isoform L2
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - SMOOTHELIN SPLICE ISOFORM L2
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P050425-09
	Expression System Vector Type	:	PLASMID
	Fragment	:	CH DOMAIN
	Gene	:	SMTN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2D87)

Sites (0, 0)

(no "Site" information available for 2D87)

SS Bonds (0, 0)

(no "SS Bond" information available for 2D87)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2D87)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2D87)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CH	PS50021	Calponin homology domain profile.	SMTN_HUMAN	799-903	1	A:8-108

Exons (4, 4)

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3b	ENST00000347557	3b	ENSE00001361117	chr22:31477305-31477442	138	SMTN_HUMAN	-	0	0	-	-
1.6a	ENST00000347557	6a	ENSE00002172144	chr22:31479165-31479295	131	SMTN_HUMAN	1-17	17	0	-	-
1.8i	ENST00000347557	8i	ENSE00001597913	chr22:31483951-31484099	149	SMTN_HUMAN	18-67	50	0	-	-
1.9e	ENST00000347557	9e	ENSE00001756048	chr22:31484499-31484592	94	SMTN_HUMAN	67-98	32	0	-	-
1.10b	ENST00000347557	10b	ENSE00001302954	chr22:31484685-31484763	79	SMTN_HUMAN	99-125	27	0	-	-
1.11b	ENST00000347557	11b	ENSE00001316324	chr22:31484858-31484955	98	SMTN_HUMAN	125-157	33	0	-	-
1.12d	ENST00000347557	12d	ENSE00001299128	chr22:31485685-31486005	321	SMTN_HUMAN	158-264	107	0	-	-
1.13	ENST00000347557	13	ENSE00001328232	chr22:31486094-31486166	73	SMTN_HUMAN	265-289	25	0	-	-
1.14	ENST00000347557	14	ENSE00001300117	chr22:31486794-31486865	72	SMTN_HUMAN	289-313	25	0	-	-
1.15c	ENST00000347557	15c	ENSE00001315900	chr22:31486947-31487468	522	SMTN_HUMAN	313-487	175	0	-	-
1.16	ENST00000347557	16	ENSE00001296322	chr22:31487661-31487833	173	SMTN_HUMAN	487-544	58	0	-	-
1.19a	ENST00000347557	19a	ENSE00001731665	chr22:31491289-31491441	153	SMTN_HUMAN	545-595	51	0	-	-
1.19c	ENST00000347557	19c	ENSE00001309179	chr22:31491520-31491595	76	SMTN_HUMAN	596-621	26	0	-	-
1.19f	ENST00000347557	19f	ENSE00001324643	chr22:31492719-31492883	165	SMTN_HUMAN	621-676	56	0	-	-
1.20a	ENST00000347557	20a	ENSE00001303034	chr22:31492984-31493046	63	SMTN_HUMAN	676-697	22	0	-	-
1.20c	ENST00000347557	20c	ENSE00001292824	chr22:31493255-31493324	70	SMTN_HUMAN	697-720	24	0	-	-
1.21	ENST00000347557	21	ENSE00001316053	chr22:31494653-31494826	174	SMTN_HUMAN	720-778	59	1	A:1-4	4
1.22b	ENST00000347557	22b	ENSE00001298845	chr22:31495048-31495165	118	SMTN_HUMAN	778-817	40	1	A:4-24 (gaps)	40
1.22e	ENST00000347557	22e	ENSE00001296032	chr22:31495731-31495882	152	SMTN_HUMAN	818-868	51	1	A:25-75	51
1.24d	ENST00000347557	24d	ENSE00001836597	chr22:31500302-31500610	309	SMTN_HUMAN	868-917	50	1	A:75-123 (gaps)	50

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:128
 aligned with SMTN_HUMAN | P53814 from UniProtKB/Swiss-Prot  Length:917

    Alignment length:148
                                                                                                                                                                        917     
                                   784       794       804       814       824       834       844       854       864       874       884       894       904       914  |     
           SMTN_HUMAN   775 GAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHELRLRGKNV-----   -
               SCOP domains d2d87a_                    A: automated matches                                                                                                      SCOP domains
               CATH domains -----2d                   87A01 A:6-113 Actin-binding Protein, T-fimbrin; domain 1                                                   --------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......h-------------------hhhhhhhhhhhhh.................hhhhhhhhhhhh............hhhhhhhhhhhhhhhhhh.....hhhhhhhh-...hhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------CH  PDB: A:8-108 UniProt: 799-903                                                                        ------------------- PROSITE
           Transcript 1 (1) 1.21---------------------------------------Exon 1.22e  PDB: A:25-75 UniProt: 818-868          ------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.22b  PDB: A:4-24 (gaps)          --------------------------------------------------Exon 1.24d  PDB: A:75-123 (gaps) UniProt: 868-917 ----- Transcript 1 (2)
                 2d87 A   1 GSSGSSG-------------------IKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRL-REPDWKCVYTYIQEFYRCLVQKGLVKTKKSSGPSSG 128
                                  |  -         -      | 11        21        31        41        51        61        71        81        91| |    100       110       120        
                                  7                   8                                                                                  92 |                                   
                                                                                                                                           93

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: CH domain-like (55)

Superfamily: Calponin-homology domain, CH-domain (53)

Family: automated matches (25)

Protein domain: automated matches (25)

Human (Homo sapiens) [TaxId: 9606] (23)

d2d87a_

CATH Domains (1, 1)

NMR Structure

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Actin-binding Protein, T-fimbrin; domain 1 (51)

Homologous Superfamily: Actin-binding Protein, T-fimbrin; domain 1 (51)

Human (Homo sapiens) (39)

2d87A01

A:6-113

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2D87)

Gene Ontology (8, 8)

NMR Structure(hide GO term definitions)

Chain A (SMTN_HUMAN | P53814)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0008307	structural constituent of muscle	The action of a molecule that contributes to the structural integrity of a muscle fiber.
biological process
	GO:0007517	muscle organ development	The process whose specific outcome is the progression of the muscle over time, from its formation to the mature structure. The muscle is an organ consisting of a tissue made up of various elongated cells that are specialized to contract and thus to produce movement and mechanical work.
	GO:0006939	smooth muscle contraction	A process in which force is generated within smooth muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Smooth muscle differs from striated muscle in the much higher actin/myosin ratio, the absence of conspicuous sarcomeres and the ability to contract to a much smaller fraction of its resting length.
cellular component
	GO:0015629	actin cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2d87)

	Sites
(no "Sites" information available for 2d87)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d87)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2d87
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SMTN_HUMAN \| P53814
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SMTN_HUMAN \| P53814
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File