|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2D7L) |
Sites (0, 0)| (no "Site" information available for 2D7L) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2D7L) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2D7L) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D7L) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (3, 3)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:81 aligned with WDHD1_HUMAN | O75717 from UniProtKB/Swiss-Prot Length:1129 Alignment length:123 982 992 1002 1012 1022 1032 1042 1052 1062 1072 1082 1092 WDHD1_HUMAN 973 ASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETEN 1095 SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------HMG_BOX_2 PDB: A:8-75 UniProt: 1015-1084 ----------- PROSITE Transcript 1 (1) Exon 1.23 PDB: A:1-8 (gaps) ----------------------------------------------Exon 1.25d PDB: A:55-81 (gaps) Transcript 1 (1) Transcript 1 (2) --------------------------------------------Exon 1.24b PDB: A:8-54 UniProt: 1017-1063 -------------------------------- Transcript 1 (2) 2d7l A 1 GSSGS-------------------------------------SGRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRK-----SGPSSG 81 | - - - - | 13 23 33 43 53 63 73 | |78 5 6 75 76
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2D7L) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2D7L) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D7L) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (WDHD1_HUMAN | O75717)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|