|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2D36) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D36) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2D36) |
Exons (0, 0)| (no "Exon" information available for 2D36) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:154 aligned with Q974C9_SULTO | Q974C9 from UniProtKB/TrEMBL Length:156 Alignment length:154 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Q974C9_SULTO 1 MAEVIKSIMRKFPLGVAIVTTNWKGELVGMTVNTFNSLSLNPPLVSFFADRMKGNDIPYKESKYFVVNFTDNEELFNIFALKPVKERFREIKYKEGIGGCPILYDSYAYIEAKLYDTIDVGDHSIIVGEVIDGYQIRDNFTPLVYMNRKYYKLS 154 SCOP domains d2d36a_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2d36 A 1 MAEVIKSIMRKFPLGVAIVTTNWKGELVGMTVNTFNSLSLNPPLVSFFADRMKGNDIPYKESKYFVVNFTDNEELFNIFALKPVKERFREIKYKEGIGGCPILYDSYAYIEAKLYDTIDVGDHSIIVGEVIDGYQIRDNFTPLVYMNRKYYKLS 154 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2D36) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D36) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q974C9_SULTO | Q974C9)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|