Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CYTOCHROME C552 FROM MODERATE THERMOPHILIC BACTERIUM, HYDROGENOPHILUS THERMOLUTEOLUS
 
Authors :  S. Nakamura, S. I. Ichiki, H. Takashima, S. Uchiyama, J. Hasegawa, Y. Kobayashi, Y. Sambongi, T. Ohkubo
Date :  08 Aug 05  (Deposition) - 23 May 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Heme Protein, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Nakamura, S. I. Ichiki, H. Takashima, S. Uchiyama, J. Hasegawa, Y. Kobayashi, Y. Sambongi, T. Ohkubo
Structure Of Cytochrome C552 From A Moderate Thermophilic Bacterium, Hydrogenophilus Thermoluteolus: Comparative Study On The Thermostability Of Cytochrome C
Biochemistry V. 45 6115 2006
PubMed-ID: 16681384  |  Reference-DOI: 10.1021/BI0520131
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPKK223-3, PEC86
    Expression System StrainJCB387
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 1-79
    Organism ScientificHYDROGENOPHILUS THERMOLUTEOLUS
    Organism Taxid297
    SynonymCYTOCHROME C552

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HEC1Ligand/IonHEME C

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:10 , CYS A:13 , HIS A:14 , TYR A:32 , LYS A:43 , GLY A:48 , ALA A:49 , GLY A:50 , VAL A:51 , TRP A:52 , GLY A:53 , VAL A:55 , MET A:57 , PRO A:58 , HIS A:60 , ILE A:71 , ARG A:73 , HOH A:82BINDING SITE FOR RESIDUE HEC A 80

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2D0S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2D0S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2D0S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2D0S)

(-) Exons   (0, 0)

(no "Exon" information available for 2D0S)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:79
 aligned with Q76IQ6_HYDTE | Q76IQ6 from UniProtKB/TrEMBL  Length:102

    Alignment length:79
                                    33        43        53        63        73        83        93         
         Q76IQ6_HYDTE    24 DEALAKAKGCMACHAIDKKLVGPSYKDVAKKYTEADVPKLVEKVKKGGAGVWGPVPMPPHPQVAEADIEKIVRWVLTLK 102
               SCOP domains d2d0sa_ A: automated matches                                                    SCOP domains
               CATH domains 2d0sA00 A:1-79 Cytochrome c                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 2d0s A   1 DEALAKAKGCMACHAIDKKLVGPSYKDVAKKYTEADVPKLVEKVKKGGAGVWGPVPMPPHPQVAEADIEKIVRWVLTLK  79
                                    10        20        30        40        50        60        70         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2D0S)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q76IQ6_HYDTE | Q76IQ6)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d0s)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2d0s
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q76IQ6_HYDTE | Q76IQ6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q76IQ6_HYDTE | Q76IQ6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2D0S)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2D0S)