|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2D0S) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2D0S) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D0S) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2D0S) |
Exons (0, 0)| (no "Exon" information available for 2D0S) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:79 aligned with Q76IQ6_HYDTE | Q76IQ6 from UniProtKB/TrEMBL Length:102 Alignment length:79 33 43 53 63 73 83 93 Q76IQ6_HYDTE 24 DEALAKAKGCMACHAIDKKLVGPSYKDVAKKYTEADVPKLVEKVKKGGAGVWGPVPMPPHPQVAEADIEKIVRWVLTLK 102 SCOP domains d2d0sa_ A: automated matches SCOP domains CATH domains 2d0sA00 A:1-79 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2d0s A 1 DEALAKAKGCMACHAIDKKLVGPSYKDVAKKYTEADVPKLVEKVKKGGAGVWGPVPMPPHPQVAEADIEKIVRWVLTLK 79 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D0S) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q76IQ6_HYDTE | Q76IQ6)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|