Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PH0766 FROM PYROCOCCUS HORIKOSHII OT3
 
Authors :  M. Sugahara, N. Kunishima, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  23 May 05  (Deposition) - 01 Aug 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Pyrococcus Horikoshii, Structural Genomics, Ph0766, Riken Structural Genomics/Proteomics Initiative, Rsgi, Nppsfa, National Project On Protein Structural And Functional Analyses, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Sugahara, N. Kunishima
Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 457AA LONG HYPOTHETICAL PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET11A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificPYROCOCCUS HORIKOSHII
    Organism Taxid70601
    StrainOT3

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 30)

Asymmetric/Biological Unit (1, 30)
No.NameCountTypeFull Name
1MSE30Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2CSU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CSU)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gly A:126 -Pro A:127
2Mse A:411 -Ala A:412
3Gly B:126 -Pro B:127
4Mse B:411 -Ala B:412

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CSU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2CSU)

(-) Exons   (0, 0)

(no "Exon" information available for 2CSU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:435
 aligned with O58493_PYRHO | O58493 from UniProtKB/TrEMBL  Length:457

    Alignment length:453
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450   
         O58493_PYRHO     1 MLDYFFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGMRIIGPNCVGIMNTHVDLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNMADVDFAELMEYLADTEEDKAIALYIEGVRNGKKFMEVAKRVTKKKPIIALKAGKSESGARAASSHTGSLAGSWKIYEAAFKQSGVLVANTIDEMLSMARAFSQPLPRGNKVAIMTNAGGPGVLTADELDKRGLKLATLEEKTIEELRSFLPPMAAVKNPVDMIASARGEDYYRTAKLLLQDPNVDMLIAICVVPTFAGMTLTEHAEGIIRAVKEVNNEKPVLAMFMAGYVSEKAKELLEKNGIPTYERPEDVASAAYALVEQAKNVGI 453
               SCOP domains d2csua1 A:1-129 Acetate-CoA ligase alpha chain, AcdA, N-terminal domain                                                          d2csua2 A:130-290 Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3                                                                                          d2csua3 A:291-453 Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3                                                                                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeee.......hhhhhhhhhhh.....eeeee.....ee..ee.............eeee..hhhhhhhhhhhhhhhh..eeee........hhhhhhhhhhhhhhhhhhh.eee.....eeee.hhheeee.....ee..eeeee.hhhhhhhhhhhhhhh..ee.eeee.......hhhhhhhhhh......eeeeee....hhhhhhhhhhhhhhhh.eeeee..------------------hhhhhhhhhhhh..eee.hhhhhhhhhh..........eeeeee.hhhhhhhhhhhhhh...ee...hhhhhhhhhhhh....ee..eee.....hhhhhhhhhhhhhhh....eeeeeee.........hhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhh....ee.hhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2csu A   1 mLDYFFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGmRIIGPNCVGImNTHVDLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNmADVDFAELmEYLADTEEDKAIALYIEGVRNGKKFmEVAKRVTKKKPIIALKAG------------------SWKIYEAAFKQSGVLVANTIDEmLSmARAFSQPLPRGNKVAImTNAGGPGVLTADELDKRGLKLATLEEKTIEELRSFLPPmAAVKNPVDmIASARGEDYYRTAKLLLQDPNVDmLIAICVVPTFAGmTLTEHAEGIIRAVKEVNNEKPVLAmFmAGYVSEKAKELLEKNGIPTYERPEDVASAAYALVEQAKNVGI 453
                            |       10        20        30        40        50        60        70        80        90       100       110       120 |     130  |    140       150       160       170       180    |  190   |   200       210       220       230       | -         -      |260       270       280 |     290       300       310       320       330       340      |350       360       370|      380   |   390       400       410|      420       430       440       450   
                            |                                                                                                                      122-MSE    133-MSE                                             185-MSE  194-MSE                   220-MSE           238                257                   279-MSE             299-MSE                                338-MSE  347-MSE                 371-MSE      384-MSE                  409-MSE                                        
                            1-MSE                                                                                                                                                                                                                                                                                  282-MSE                                                                                                                          411-MSE                                      

Chain B from PDB  Type:PROTEIN  Length:434
 aligned with O58493_PYRHO | O58493 from UniProtKB/TrEMBL  Length:457

    Alignment length:453
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450   
         O58493_PYRHO     1 MLDYFFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGMRIIGPNCVGIMNTHVDLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNMADVDFAELMEYLADTEEDKAIALYIEGVRNGKKFMEVAKRVTKKKPIIALKAGKSESGARAASSHTGSLAGSWKIYEAAFKQSGVLVANTIDEMLSMARAFSQPLPRGNKVAIMTNAGGPGVLTADELDKRGLKLATLEEKTIEELRSFLPPMAAVKNPVDMIASARGEDYYRTAKLLLQDPNVDMLIAICVVPTFAGMTLTEHAEGIIRAVKEVNNEKPVLAMFMAGYVSEKAKELLEKNGIPTYERPEDVASAAYALVEQAKNVGI 453
               SCOP domains d2csub1 B:1-129 Acetate-CoA ligase alpha chain, AcdA, N-terminal domain                                                          d2csub2 B:130-290 Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3                                                                                          d2csub3 B:291-453 Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3                                                                                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..eeeee.......hhhhhhhhhhh.....eeeee........................eeee..hhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhhhh..eee.....eeee.hhheeee.........eeeee.hhhhhhhhhhhhhhh.....eeee.......hhhhhhhhhhh.....eeeeee....hhhhhhhhhhhhh....eeeee...-------------------hhhhhhhhhhheeee.hhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhhhh....ee...hhhhhhhhhhhh....ee..eee.....hhhhhhhhhhhhhhh....eeeeeee.........hhhhhhhhhhhhhhh....eeeeeehhhhhhhhhhhhhhh...ee.hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2csu B   1 mLDYFFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGmRIIGPNCVGImNTHVDLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNmADVDFAELmEYLADTEEDKAIALYIEGVRNGKKFmEVAKRVTKKKPIIALKAGK-------------------KIYEAAFKQSGVLVANTIDEmLSmARAFSQPLPRGNKVAImTNAGGPGVLTADELDKRGLKLATLEEKTIEELRSFLPPmAAVKNPVDmIASARGEDYYRTAKLLLQDPNVDmLIAICVVPTFAGmTLTEHAEGIIRAVKEVNNEKPVLAmFmAGYVSEKAKELLEKNGIPTYERPEDVASAAYALVEQAKNVGI 453
                            |       10        20        30        40        50        60        70        80        90       100       110       120 |     130  |    140       150       160       170       180    |  190   |   200       210       220       230        |-         -       260       270       280 |     290       300       310       320       330       340      |350       360       370|      380   |   390       400       410|      420       430       440       450   
                            1-MSE                                                                                                                  122-MSE    133-MSE                                             185-MSE  194-MSE                   220-MSE            239                 259                 279-MSE             299-MSE                                338-MSE  347-MSE                 371-MSE      384-MSE                  409-MSE                                        
                                                                                                                                                                                                                                                                                                                   282-MSE                                                                                                                          411-MSE                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CSU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CSU)

(-) Gene Ontology  (1, 1)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (O58493_PYRHO | O58493)
molecular function
    GO:0048037    cofactor binding    Interacting selectively and non-covalently with a cofactor, a substance that is required for the activity of an enzyme or other protein. Cofactors may be inorganic, such as the metal atoms zinc, iron, and copper in certain forms, or organic, in which case they are referred to as coenzymes. Cofactors may either be bound tightly to active sites or bind loosely with the substrate.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2csu)
 
  Cis Peptide Bonds
    Gly A:126 - Pro A:127   [ RasMol ]  
    Gly B:126 - Pro B:127   [ RasMol ]  
    Mse A:411 - Ala A:412   [ RasMol ]  
    Mse B:411 - Ala B:412   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2csu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O58493_PYRHO | O58493
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O58493_PYRHO | O58493
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CSU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CSU)