|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2CRP) |
(no "Site" information available for 2CRP) |
(no "SS Bond" information available for 2CRP) |
(no "Cis Peptide Bond" information available for 2CRP) |
(no "SAP(SNP)/Variant" information available for 2CRP) |
NMR Structure (1, 1)
|
NMR Structure (4, 4)
|
NMR StructureChain A from PDB Type:PROTEIN Length:150 aligned with RGS5_HUMAN | O15539 from UniProtKB/Swiss-Prot Length:181 Alignment length:156 181 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180| RGS5_HUMAN 31 DSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK----- - SCOP domains d2cr pa_ A: automated matches SCOP domains CATH domains ----------------------2crpA01 A:17-49,A:130-150 2crpA02 A:50-129 Regulator of G-protein Signalling 4, domain 2 2crpA01 CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ---------------------------------RGS PDB: A:28-144 UniProt: 64-180 ------ PROSITE Transcript 1 (1) Exon 1.4 [INCOMPLETE] --------------------Exon 1.6b PDB: A:37-92 UniProt: 73-128 Exon 1.7d PDB: A:93-145 UniProt: 129-181 ----- Transcript 1 (1) Transcript 1 (2) ---------------------Exon 1.5 PDB: A:16-37----------------------------------------------------------------------------------------------------------------- Transcript 1 (2) 2crp A 1 GSSG------SSGPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELISGPSSG 150 | -| 14 24 34 44 54 64 74 84 94 104 114 124 134 144 4 5
|
NMR Structure
|
NMR Structure
|
(no "Pfam Domain" information available for 2CRP) |
NMR Structure(hide GO term definitions) Chain A (RGS5_HUMAN | O15539)
|
|
|
|
|
|
|