2CPW - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF RSGI RUH-031, A UBA DOMAIN FROM HUMAN CDNA

Authors :   A. Z. M. Ruhul Momen, H. Onuki, H. Hirota, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   19 May 05 (Deposition) - 19 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Ubiquitin Associated Domain, Uba, Compact Three Helix Bundle, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Z. M. Ruhul Momen, H. Onuki, H. Hirota, F. Hayashi, S. Yokoyama
Solution Structure Of Rsgi Ruh-031, A Uba Domain From Human Cdna
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CBL-INTERACTING PROTEIN STS-1 VARIANT
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040614-08
	Expression System Vector Type	:	PLASMID
	Fragment	:	UBA DOMAIN
	Gene	:	GENBANK/AB075839
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2CPW)

(no "Site" information available for 2CPW)

(no "SS Bond" information available for 2CPW)

(no "Cis Peptide Bond" information available for 2CPW)

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052676	A	68	T	UBS3B_HUMAN	Polymorphism	12790613	A	T	50	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	UBA	PS50030	Ubiquitin-associated domain (UBA) profile.	UBS3B_HUMAN	27-76	1	A:9-58

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000284273	1a	ENSE00001268639	chr11:122526383-122526918	536	UBS3B_HUMAN	1-54	54	1	A:1-36 (gaps)	50
1.5b	ENST00000284273	5b	ENSE00001014159	chr11:122646927-122646980	54	UBS3B_HUMAN	54-72	19	1	A:36-54	19
1.6	ENST00000284273	6	ENSE00001014172	chr11:122647732-122647918	187	UBS3B_HUMAN	72-134	63	1	A:54-64 (gaps)	27
1.7c	ENST00000284273	7c	ENSE00001014167	chr11:122650205-122650403	199	UBS3B_HUMAN	135-201	67	0	-	-
1.8b	ENST00000284273	8b	ENSE00001014165	chr11:122653761-122653930	170	UBS3B_HUMAN	201-257	57	0	-	-
1.9	ENST00000284273	9	ENSE00001014163	chr11:122659808-122660016	209	UBS3B_HUMAN	258-327	70	0	-	-
1.10b	ENST00000284273	10b	ENSE00001014157	chr11:122665410-122665542	133	UBS3B_HUMAN	327-371	45	0	-	-
1.11	ENST00000284273	11	ENSE00001014160	chr11:122666864-122666984	121	UBS3B_HUMAN	372-412	41	0	-	-
1.12a	ENST00000284273	12a	ENSE00001014170	chr11:122667619-122667741	123	UBS3B_HUMAN	412-453	42	0	-	-
1.13	ENST00000284273	13	ENSE00001014158	chr11:122669650-122669742	93	UBS3B_HUMAN	453-484	32	0	-	-
1.14	ENST00000284273	14	ENSE00001014162	chr11:122671896-122672040	145	UBS3B_HUMAN	484-532	49	0	-	-
1.15	ENST00000284273	15	ENSE00001014161	chr11:122677118-122677224	107	UBS3B_HUMAN	532-568	37	0	-	-
1.16	ENST00000284273	16	ENSE00001014168	chr11:122678775-122678884	110	UBS3B_HUMAN	568-604	37	0	-	-
1.17	ENST00000284273	17	ENSE00001399355	chr11:122680457-122685181	4725	UBS3B_HUMAN	605-649	45	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:64
 aligned with UBS3B_HUMAN | Q8TF42 from UniProtKB/Swiss-Prot  Length:649

    Alignment length:94
                                    14        24        34        44        54        64        74        84        94    
           UBS3B_HUMAN    5 GHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTG 98
               SCOP domains ---------------------d2cpwa1 A:8-58 Cbl-interacting protein p70, STS1   ---------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....--------------................hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhh...--------.--------... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------T------------------------------ SAPs(SNPs)
                    PROSITE ----------------------UBA  PDB: A:9-58 UniProt: 27-76                   ---------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:1-36 (gaps) UniProt: 1-54       -----------------Exon 1.6 UniProt: 72-134    Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.5b          -------------------------- Transcript 1 (2)
                  2cpw A  1 GSSG--------------SSGRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQTACDWLFSHSG--------P--------SSG 64
                               |     -        |6        16        26        36        46        56   |     -  |      - |  
                               4              5                                                     60       61       62

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: RuvA C-terminal domain-like (106)

Superfamily: UBA-like (64)

Family: UBA domain (48)

Protein domain: Cbl-interacting protein p70, STS1 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2cpwa1

A:8-58

(no "CATH Domain" information available for 2CPW)

(no "Pfam Domain" information available for 2CPW)

NMR Structure(hide GO term definitions)

Chain A (UBS3B_HUMAN | Q8TF42)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0045779	negative regulation of bone resorption	Any process that stops, prevents, or reduces the frequency, rate or extent of bone resorption.
	GO:0045671	negative regulation of osteoclast differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of osteoclast differentiation.
	GO:0090331	negative regulation of platelet aggregation	Any process that decreases the rate, frequency or extent of platelet aggregation. Platelet aggregation is the adhesion of one platelet to one or more other platelets via adhesion molecules.
	GO:0006469	negative regulation of protein kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0045670	regulation of osteoclast differentiation	Any process that modulates the frequency, rate or extent of osteoclast differentiation.
	GO:0051279	regulation of release of sequestered calcium ion into cytosol	Any process that modulates the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cpw)

	Sites
(no "Sites" information available for 2cpw)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cpw)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2cpw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UBS3B_HUMAN \| Q8TF42
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UBS3B_HUMAN \| Q8TF42
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	UBS3B_HUMAN \| Q8TF42	:	2e5k

(no "Related Entries Specified in the PDB File" available for 2CPW)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (1, 1)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File