2COZ - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE CAP-GLY DOMAIN IN HUMAN CENTROSOME-ASSOCIATED PROTEIN CAP350

Authors :   K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   19 May 05 (Deposition) - 19 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Microtubule Binding, Cytoskeleton Associated Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Saito, S. Koshiba, M. Inoue, T. Kigawa, S. Yokoyama
Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - CENTROSOME-ASSOCIATED PROTEIN 350
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P040816-04
	Expression System Vector Type	:	PLASMID
	Fragment	:	CAP-GLY DOMAIN
	Gene	:	KAZUSA CDNA HH00807
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	CAP350

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2COZ)

Sites (0, 0)

(no "Site" information available for 2COZ)

SS Bonds (0, 0)

(no "SS Bond" information available for 2COZ)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2COZ)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2COZ)

PROSITE Motifs (2, 2)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CAP_GLY_1	PS00845	CAP-Gly domain signature.	CE350_HUMAN	2517-2548	1	A:52-83
2	CAP_GLY_2	PS50245	CAP-Gly domain profile.	CE350_HUMAN	2517-2559	1	A:52-94

Exons (1, 1)

NMR Structure (1, 1)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000367607	1a	ENSE00001858805	chr1:179923873-179924277	405	CE350_HUMAN	-	0	0	-	-
1.2a	ENST00000367607	2a	ENSE00001510509	chr1:179955304-179955389	86	CE350_HUMAN	1-25	25	0	-	-
1.3a	ENST00000367607	3a	ENSE00001120524	chr1:179956375-179956421	47	CE350_HUMAN	25-40	16	0	-	-
1.4	ENST00000367607	4	ENSE00001068581	chr1:179959642-179959756	115	CE350_HUMAN	41-79	39	0	-	-
1.5	ENST00000367607	5	ENSE00002186449	chr1:179961197-179961356	160	CE350_HUMAN	79-132	54	0	-	-
1.6b	ENST00000367607	6b	ENSE00001120486	chr1:179965688-179966310	623	CE350_HUMAN	132-340	209	0	-	-
1.7	ENST00000367607	7	ENSE00001695919	chr1:179972309-179972422	114	CE350_HUMAN	340-378	39	0	-	-
1.8a	ENST00000367607	8a	ENSE00001721365	chr1:179975589-179975702	114	CE350_HUMAN	378-416	39	0	-	-
1.9a	ENST00000367607	9a	ENSE00001623929	chr1:179981064-179981210	147	CE350_HUMAN	416-465	50	0	-	-
1.10	ENST00000367607	10	ENSE00001654305	chr1:179982982-179983640	659	CE350_HUMAN	465-684	220	0	-	-
1.11	ENST00000367607	11	ENSE00001711388	chr1:179984984-179985105	122	CE350_HUMAN	685-725	41	0	-	-
1.12b	ENST00000367607	12b	ENSE00001068573	chr1:179989084-179990144	1061	CE350_HUMAN	725-1079	355	0	-	-
1.13	ENST00000367607	13	ENSE00001780657	chr1:179991833-179991983	151	CE350_HUMAN	1079-1129	51	0	-	-
1.14	ENST00000367607	14	ENSE00001730282	chr1:179993554-179993717	164	CE350_HUMAN	1129-1184	56	0	-	-
1.15	ENST00000367607	15	ENSE00001653875	chr1:180000455-180000629	175	CE350_HUMAN	1184-1242	59	0	-	-
1.16	ENST00000367607	16	ENSE00001616473	chr1:180002997-180003217	221	CE350_HUMAN	1242-1316	75	0	-	-
1.17	ENST00000367607	17	ENSE00001756180	chr1:180006061-180006224	164	CE350_HUMAN	1316-1370	55	0	-	-
1.18a	ENST00000367607	18a	ENSE00001008346	chr1:180010273-180010383	111	CE350_HUMAN	1371-1407	37	0	-	-
1.19	ENST00000367607	19	ENSE00001008341	chr1:180010797-180010937	141	CE350_HUMAN	1408-1454	47	0	-	-
1.20	ENST00000367607	20	ENSE00001008349	chr1:180012191-180012327	137	CE350_HUMAN	1455-1500	46	0	-	-
1.21	ENST00000367607	21	ENSE00001008343	chr1:180013186-180013308	123	CE350_HUMAN	1500-1541	42	0	-	-
1.22	ENST00000367607	22	ENSE00001008353	chr1:180017671-180017840	170	CE350_HUMAN	1541-1598	58	0	-	-
1.24	ENST00000367607	24	ENSE00001068566	chr1:180022105-180022301	197	CE350_HUMAN	1598-1663	66	0	-	-
1.25b	ENST00000367607	25b	ENSE00002198417	chr1:180022885-180023069	185	CE350_HUMAN	1664-1725	62	0	-	-
1.26	ENST00000367607	26	ENSE00001604880	chr1:180023550-180023637	88	CE350_HUMAN	1725-1754	30	0	-	-
1.27	ENST00000367607	27	ENSE00001595288	chr1:180031355-180031501	147	CE350_HUMAN	1755-1803	49	0	-	-
1.28	ENST00000367607	28	ENSE00001760893	chr1:180034250-180034407	158	CE350_HUMAN	1804-1856	53	0	-	-
1.30	ENST00000367607	30	ENSE00001615900	chr1:180044157-180044356	200	CE350_HUMAN	1856-1923	68	0	-	-
1.31	ENST00000367607	31	ENSE00001673526	chr1:180047598-180047809	212	CE350_HUMAN	1923-1993	71	0	-	-
1.32	ENST00000367607	32	ENSE00001717983	chr1:180049652-180049796	145	CE350_HUMAN	1994-2042	49	0	-	-
1.33b	ENST00000367607	33b	ENSE00000822653	chr1:180053153-180053313	161	CE350_HUMAN	2042-2095	54	0	-	-
1.36	ENST00000367607	36	ENSE00000922033	chr1:180056713-180056852	140	CE350_HUMAN	2096-2142	47	0	-	-
1.37b	ENST00000367607	37b	ENSE00000790168	chr1:180059849-180059931	83	CE350_HUMAN	2142-2170	29	0	-	-
1.38a	ENST00000367607	38a	ENSE00000822655	chr1:180061749-180063751	2003	CE350_HUMAN	2170-2837	668	1	A:1-122 (gaps)	221
1.40	ENST00000367607	40	ENSE00000922034	chr1:180064658-180065065	408	CE350_HUMAN	2838-2973	136	0	-	-
1.41	ENST00000367607	41	ENSE00000922035	chr1:180065173-180065319	147	CE350_HUMAN	2974-3022	49	0	-	-
1.42	ENST00000367607	42	ENSE00000922036	chr1:180067998-180068120	123	CE350_HUMAN	3023-3063	41	0	-	-
1.43f	ENST00000367607	43f	ENSE00001829752	chr1:180080132-180084015	3884	CE350_HUMAN	3064-3117	54	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:122
 aligned with CE350_HUMAN | Q5VT06 from UniProtKB/Swiss-Prot  Length:3117

    Alignment length:221
                                  2434      2444      2454      2464      2474      2484      2494      2504      2514      2524      2534      2544      2554      2564      2574      2584      2594      2604      2614      2624      2634      2644 
         CE350_HUMAN   2425 GATSFGSNEEISECLSEKSLSIHSNVHSDRLLELKSPTELMKSKERSDVEHEQQVTESPSLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGIAYFECKEKHGIFAPPQKISHIPENFDDYVDINEDEDCYSDERYQCYNQEQNDTEGPKDREKDVSEYFYEKSLPSVNDIEASVNRSRSLKIETDNVQDISG 2645
               SCOP domains ------------------------------------------------d2coza1 A:8-116 Centrosome-associated protein 350                                                            ---------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...--..---------------------------------------..............................eeeee...eeeeeeeeee......eeeeeee.........ee..ee........eeeehhh.ee..................-----------------...-----------------------------------------.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------------------------CAP_GLY_1  PDB: A:52-83         ------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------CAP_GLY_2  PDB: A:52-94 UniProt: 2517-2559 -------------------------------------------------------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.38a  PDB: A:1-122 (gaps) UniProt: 2170-2837 [INCOMPLETE]                                                                                                                                                               Transcript 1
                2coz A    1 GSS--GS---------------------------------------SGVEHEQQVTESPSLASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGIAYFECKEKHGIFAPPQKISHIPENFDDYVDINEDEDS-----------------GPS-----------------------------------------SG  122
                              |  ||  -         -         -         -      |  9        19        29        39        49        59        69        79        89        99       109       | -         -     | | -         -         -         -       121 
                              3  4|                                       6                                                                                                            117               118 |                                       121 
                                  5                                                                                                                                                                        120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: SH3-like barrel (1035)

Superfamily: Cap-Gly domain (30)

Family: Cap-Gly domain (29)

Protein domain: Centrosome-associated protein 350 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2coza1

A:8-116

CATH Domains (0, 0)

(no "CATH Domain" information available for 2COZ)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2COZ)

Gene Ontology (11, 11)

NMR Structure(hide GO term definitions)

Chain A (CE350_HUMAN | Q5VT06)

molecular function
	GO:0008017	microtubule binding	Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0034453	microtubule anchoring	Any process in which a microtubule is maintained in a specific location in a cell.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005819	spindle	The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2coz)

	Sites
(no "Sites" information available for 2coz)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2coz)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2coz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CE350_HUMAN \| Q5VT06
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CE350_HUMAN \| Q5VT06
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)