|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2CK5) |
Sites (0, 0)| (no "Site" information available for 2CK5) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2CK5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2CK5) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2CK5) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:31 aligned with KAX37_ORTSC | P55896 from UniProtKB/Swiss-Prot Length:38 Alignment length:31 17 27 37 KAX37_ORTSC 8 CKISRQCLEPCKKAGMRFGKCMNGKCHCTPK 38 SCOP domains ------------------------------- SCOP domains CATH domains ------------------------------- CATH domains Pfam domains ------------------------------- Pfam domains SAPs(SNPs) ------------------------------- SAPs(SNPs) PROSITE ------SCORP_SHORT_TOXIN --- PROSITE Transcript ------------------------------- Transcript 2ck5 A 1 CKISRQCLKPCKDAGMRFGKCMNGKCHCTPK 31 10 20 30
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2CK5) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2CK5) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2CK5) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (KAX37_ORTSC | P55896)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|