Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE HUMAN MAN1 C-TERMINAL DOMAIN (RESIDUES 655-775)
 
Authors :  S. Caputo, J. Couprie, I. Duband-Goulet, F. Lin, S. Braud, M. Gondry, H. J. Worman, B. Gilquin, S. Zinn-Justin
Date :  10 Mar 06  (Deposition) - 16 May 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Man1, Winged Helix Motif, Dna, Nuclear Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Caputo, J. Couprie, I. Duband-Goulet, F. Lin, S. Braud, M. Gondry, H. J. Worman, B. Gilquin, S. Zinn-Justin
The Carboxyl-Terminal Nucleoplasmic Region Of Man1 Exhibits A Dna Binding Winged Helix Domain.
J. Biol. Chem. V. 281 18208 2006
PubMed-ID: 16648637  |  Reference-DOI: 10.1074/JBC.M601980200

(-) Compounds

Molecule 1 - INNER NUCLEAR MEMBRANE PROTEIN MAN1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX-4T-1
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: 655-775
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: LEM DOMAIN CONTAINING PROTEIN 3

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CH0)

(-) Sites  (0, 0)

(no "Site" information available for 2CH0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2CH0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CH0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2CH0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2CH0)

(-) Exons   (6, 6)

NMR Structure (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003083301ENSE00001208170chr12:65563371-655648981528MAN1_HUMAN1-5085080--
1.2ENST000003083302ENSE00000751368chr12:65604706-6560474338MAN1_HUMAN508-520130--
1.3ENST000003083303ENSE00000751406chr12:65609757-6560982367MAN1_HUMAN521-543230--
1.4ENST000003083304ENSE00000751407chr12:65612332-6561239968MAN1_HUMAN543-565231A:1-22
1.5ENST000003083305ENSE00000751408chr12:65632282-6563236180MAN1_HUMAN566-592270--
1.6ENST000003083306ENSE00000751409chr12:65632449-65632594146MAN1_HUMAN592-641501A:3-42
1.7ENST000003083307ENSE00000751410chr12:65633709-65633810102MAN1_HUMAN641-675351A:5-2622
1.8ENST000003083308ENSE00000751411chr12:65633916-65634018103MAN1_HUMAN675-709351A:26-6035
1.9ENST000003083309ENSE00000751412chr12:65634689-65634867179MAN1_HUMAN709-769611A:60-12061
1.10ENST0000030833010ENSE00000751413chr12:65637168-6563724982MAN1_HUMAN769-796281A:120-133 (gaps)22
1.11ENST0000030833011ENSE00000751414chr12:65639449-65639554106MAN1_HUMAN796-831360--
1.12ENST0000030833012ENSE00000751417chr12:65639641-6563971979MAN1_HUMAN832-858270--
1.13ENST0000030833013ENSE00001248858chr12:65639942-656421072166MAN1_HUMAN858-911540--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:133
 aligned with MAN1_HUMAN | Q9Y2U8 from UniProtKB/Swiss-Prot  Length:911

    Alignment length:243
                                   557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767       777       787   
           MAN1_HUMAN   548 GSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEEELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRN 790
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..------------------------------------------------..------------------------------------------------------............hhhhhhhhhhhhhhhhhhhhh.........hhhhhhhh...hhhhhhhhhhhhhhhhhhh....eeeeeeee...eeeeeeee................................--------.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4          Exon 1.5  PDB: -           ------------------------------------------------Exon 1.7  PDB: A:5-26 [INCOMPLETE] ---------------------------------------------------------------------------------------------Exon 1.10 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.6  PDB: A:3-4 UniProt: 592-641 [INCOMPLETE]---------------------------------Exon 1.8  PDB: A:26-60             --------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9  PDB: A:60-120 UniProt: 709-769                     --------------------- Transcript 1 (3)
                 2ch0 A   1 GS------------------------------------------------PE------------------------------------------------------FRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRLERPH--------RD 133
                             |       -         -         -         -         -||       -         -         -         -         -      |  8        18        28        38        48        58        68        78        88        98       108       118       128  |      - | 
                             2                                                3|                                                      5                                                                                                                           131      132 
                                                                               4
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2CH0)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2CH0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CH0)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)
Chain A   (MAN1_HUMAN | Q9Y2U8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030514    negative regulation of BMP signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the BMP signaling pathway.
    GO:0032926    negative regulation of activin receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:0030512    negative regulation of transforming growth factor beta receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of any TGF-beta receptor signaling pathway.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005639    integral component of nuclear inner membrane    The component of the nuclear inner membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005637    nuclear inner membrane    The inner, i.e. lumen-facing, lipid bilayer of the nuclear envelope.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ch0)
 
  Sites
(no "Sites" information available for 2ch0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ch0)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ch0
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MAN1_HUMAN | Q9Y2U8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MAN1_HUMAN | Q9Y2U8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2CH0)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CH0)