2C6X - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF BACILLUS SUBTILIS CITRATE SYNTHASE

Authors :   C. Vogl, D. W. Hough, M. J. Danson, S. J. Crennell

Date :   14 Nov 05 (Deposition) - 26 Jun 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Tricarboxylic Acid Cycle, Transferase, Citrate Synthase, Allosteric Enzyme, Bacillus Subtilis, Enzyme Thermostability (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Vogl, D. W. Hough, M. J. Danson, S. J. Crennell
Domain Closure In Citrate Synthases Adapted To The Range Of Biological Temperatures
To Be Published
PubMed: search

Molecule 1 - CITRATE SYNTHASE 1
	Chains	:	A, B, C, D
	EC Number	:	2.3.3.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PREC7
	Expression System Strain	:	MOB154
	Expression System Taxid	:	562
	Fragment	:	RESIDUES, 2-364
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423
	Other Details	:	GERMAN COLLECTION OF MICROORGANISMS (DSM)
	Strain	:	168
	Synonym	:	CITRATE SYNTHASE I
	Variant	:	DSM 402

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 8)

No.	Name	Count	Type	Full Name
1	CIT	4	Ligand/Ion	CITRIC ACID
2	COZ	4	Ligand/Ion	COENZYME A

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	CIT	2	Ligand/Ion	CITRIC ACID
2	COZ	2	Ligand/Ion	COENZYME A

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	CIT	2	Ligand/Ion	CITRIC ACID
2	COZ	2	Ligand/Ion	COENZYME A

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:144 , ALA A:219 , ARG A:246 , LEU A:247 , MET A:248 , PHE A:250 , GLY A:251 , HIS A:252 , ARG A:253 , LYS A:297 , ARG A:300 , LEU A:302 , ASN A:305 , GLU A:307	BINDING SITE FOR RESIDUE COZ A1365
2	AC2	SOFTWARE	HIS A:178 , ASN A:181 , HIS A:213 , GLY A:214 , ARG A:261 , GLU A:307 , ARG A:332 , ARG B:351	BINDING SITE FOR RESIDUE CIT A1366
3	AC3	SOFTWARE	ALA B:219 , ARG B:246 , LEU B:247 , MET B:248 , PHE B:250 , GLY B:251 , HIS B:252 , ARG B:253 , LYS B:297 , ARG B:300 , LEU B:302 , ASN B:305 , GLU B:307	BINDING SITE FOR RESIDUE COZ B1365
4	AC4	SOFTWARE	ARG A:351 , HIS B:178 , ASN B:181 , HIS B:213 , GLY B:214 , ARG B:261 , GLU B:307 , ARG B:332	BINDING SITE FOR RESIDUE CIT B1366
5	AC5	SOFTWARE	GLN C:144 , ALA C:219 , ARG C:246 , LEU C:247 , MET C:248 , PHE C:250 , GLY C:251 , HIS C:252 , ARG C:253 , LYS C:297 , ARG C:300 , LEU C:302 , ASN C:305 , GLU C:307	BINDING SITE FOR RESIDUE COZ C1365
6	AC6	SOFTWARE	HIS C:178 , ASN C:181 , HIS C:213 , GLY C:214 , ARG C:261 , GLU C:307 , ARG C:332 , ARG D:351	BINDING SITE FOR RESIDUE CIT C1366
7	AC7	SOFTWARE	ALA D:219 , ARG D:246 , LEU D:247 , MET D:248 , PHE D:250 , GLY D:251 , HIS D:252 , ARG D:253 , LYS D:297 , ARG D:300 , LEU D:302 , ASN D:305 , GLU D:307	BINDING SITE FOR RESIDUE COZ D1365
8	AC8	SOFTWARE	ARG C:351 , HIS D:178 , ASN D:181 , HIS D:213 , GLY D:214 , ARG D:261 , GLU D:307 , ARG D:332	BINDING SITE FOR RESIDUE CIT D1366

(no "SS Bond" information available for 2C6X)

(no "Cis Peptide Bond" information available for 2C6X)

(no "SAP(SNP)/Variant" information available for 2C6X)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CITRATE_SYNTHASE	PS00480	Citrate synthase signature.	CISY_BACSU	249-261	4	A:249-261 B:249-261 C:249-261 D:249-261

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CITRATE_SYNTHASE	PS00480	Citrate synthase signature.	CISY_BACSU	249-261	2	A:249-261 B:249-261 - -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CITRATE_SYNTHASE	PS00480	Citrate synthase signature.	CISY_BACSU	249-261	2	- - C:249-261 D:249-261

(no "Exon" information available for 2C6X)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:363
 aligned with CISY_BACSU | P39119 from UniProtKB/Swiss-Prot  Length:366

    Alignment length:363
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   
           CISY_BACSU     2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------2c6xA01 A:12-214,A:318-350 Citrate Synthase, domain 1                                                                                                                                                      2c6xA02 A:215-317 Cytochrome P450-Terp, domain 2                                                       2c6xA01 A:12-214,A:318-350       -------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee.eeeeeeeeeeeeee...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhh...............hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh........eeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c6x A   2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361

Chain B from PDB  Type:PROTEIN  Length:363
 aligned with CISY_BACSU | P39119 from UniProtKB/Swiss-Prot  Length:366

    Alignment length:363
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   
           CISY_BACSU     2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------2c6xB01 B:12-214,B:318-350 Citrate Synthase, domain 1                                                                                                                                                      2c6xB02 B:215-317 Cytochrome P450-Terp, domain 2                                                       2c6xB01 B:12-214,B:318-350       -------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee..eeee....eeee..eehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhh...............hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........eee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c6x B   2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361

Chain C from PDB  Type:PROTEIN  Length:363
 aligned with CISY_BACSU | P39119 from UniProtKB/Swiss-Prot  Length:366

    Alignment length:363
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   
           CISY_BACSU     2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------2c6xC01 C:12-214,C:318-350 Citrate Synthase, domain 1                                                                                                                                                      2c6xC02 C:215-317 Cytochrome P450-Terp, domain 2                                                       2c6xC01 C:12-214,C:318-350       -------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee.eeeeeeeeeeeeee...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhh...............hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........eee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c6x C   2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361

Chain D from PDB  Type:PROTEIN  Length:363
 aligned with CISY_BACSU | P39119 from UniProtKB/Swiss-Prot  Length:366

    Alignment length:363
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361   
           CISY_BACSU     2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------2c6xD01 D:12-214,D:318-350 Citrate Synthase, domain 1                                                                                                                                                      2c6xD02 D:215-317 Cytochrome P450-Terp, domain 2                                                       2c6xD01 D:12-214,D:318-350       -------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eee..eeee....eeee..eehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh...hhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhh.....hhhhhhhhhhhh...............hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.........eee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CITRATE_SYNTH------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2c6x D   2 VHYGLKGITCVETSISHIDGEKGRLIYRGHHAKDIALNHSFEEAAYLILFGKLPSTEELQVFKDKLAAERNLPEHIERLIQSLPNNMDDMSVLRTVVSALGENTYTFHPKTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQYGHVENYYYMLTGEQPSEAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIGEKEHAEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVAGNDRDLDLALHVEAEAIRLLEIYKPGRKLYTNVEFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTGAIPEEV 364
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2C6X)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Citrate Synthase; domain 1 (32)

Homologous Superfamily: Citrate Synthase, domain 1 (32)

Bacillus subtilis. Organism_taxid: 1423. Strain: 168. Variant: dsm 402. (1)

1a	2c6xA01	A:12-214,A:318-350
1b	2c6xB01	B:12-214,B:318-350
1c	2c6xC01	C:12-214,C:318-350
1d	2c6xD01	D:12-214,D:318-350

Topology: Cytochrome p450-Terp; domain 2 (32)

Homologous Superfamily: Cytochrome P450-Terp, domain 2 (32)

Bacillus subtilis. Organism_taxid: 1423. Strain: 168. Variant: dsm 402. (1)

2a	2c6xA02	A:215-317
2b	2c6xB02	B:215-317
2c	2c6xC02	C:215-317
2d	2c6xD02	D:215-317

(no "Pfam Domain" information available for 2C6X)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (CISY_BACSU | P39119)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0046912	transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor), with the acyl group being converted into alkyl on transfer.
biological process
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006099	tricarboxylic acid cycle	A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		COZ	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2c6x)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2c6x
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CISY_BACSU \| P39119
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.3.3.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CISY_BACSU \| P39119
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2C6X)

(no "Related Entries Specified in the PDB File" available for 2C6X)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File