|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2BZB) |
(no "Site" information available for 2BZB) |
(no "SS Bond" information available for 2BZB) |
(no "Cis Peptide Bond" information available for 2BZB) |
(no "SAP(SNP)/Variant" information available for 2BZB) |
(no "PROSITE Motif" information available for 2BZB) |
(no "Exon" information available for 2BZB) |
NMR StructureChain A from PDB Type:PROTEIN Length:62 aligned with Q81SJ3_BACAN | Q81SJ3 from UniProtKB/TrEMBL Length:72 Alignment length:62 72 28 38 48 58 68 | - Q81SJ3_BACAN 19 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHK-------- - SCOP domains d2bzba1 A:1-54 Hypothetical protein BAS1536 -------- SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2bzb A 1 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH 62 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:62 aligned with Q81SJ3_BACAN | Q81SJ3 from UniProtKB/TrEMBL Length:72 Alignment length:62 72 28 38 48 58 68 | - Q81SJ3_BACAN 19 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHK-------- - SCOP domains d2bzbb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2bzb B 1 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH 62 10 20 30 40 50 60
|
NMR Structure |
(no "CATH Domain" information available for 2BZB) |
(no "Pfam Domain" information available for 2BZB) |
NMR Structure(hide GO term definitions) Chain A,B (Q81SJ3_BACAN | Q81SJ3)
|
|
|
|
|
|
|