|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2BZB) |
Sites (0, 0)| (no "Site" information available for 2BZB) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2BZB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BZB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BZB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BZB) |
Exons (0, 0)| (no "Exon" information available for 2BZB) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:62 aligned with Q81SJ3_BACAN | Q81SJ3 from UniProtKB/TrEMBL Length:72 Alignment length:62 72 28 38 48 58 68 | - Q81SJ3_BACAN 19 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHK-------- - SCOP domains d2bzba1 A:1-54 Hypothetical protein BAS1536 -------- SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2bzb A 1 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH 62 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:62 aligned with Q81SJ3_BACAN | Q81SJ3 from UniProtKB/TrEMBL Length:72 Alignment length:62 72 28 38 48 58 68 | - Q81SJ3_BACAN 19 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHK-------- - SCOP domains d2bzbb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2bzb B 1 MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH 62 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (2, 2)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2BZB) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BZB) |
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A,B (Q81SJ3_BACAN | Q81SJ3)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|