Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  BLRB - A BLUF PROTEIN, DARK STATE STRUCTURE
 
Authors :  A. Jung, T. Domratcheva, M. Tarutina, Q. Wu, W. H. Ko, R. L. Shoeman, M. Go K. H. Gardner, I. Schlichting
Date :  29 Jul 05  (Deposition) - 24 Aug 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Signaling Protein, Photoreceptor, Flavin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Jung, T. Domratcheva, M. Tarutina, Q. Wu, W. H. Ko, R. L. Shoeman, M. Gomelsky, K. H. Gardner, I. Schlichting
Structure Of A Bacterial Bluf Photoreceptor: Insights Into Blue Light-Mediated Signal Transduction.
Proc. Natl. Acad. Sci. Usa V. 102 12350 2005
PubMed-ID: 16107542  |  Reference-DOI: 10.1073/PNAS.0500722102

(-) Compounds

Molecule 1 - BLUE-LIGHT RECEPTOR OF THE BLUF-FAMILY
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PHIS-GB1-PARALLEL1
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: RHODOBACTER SPHAEROIDES
    Organism Taxid: 1063
    Synonym: BLRB, BLUE LIGHT SENSING

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:9 , ILE A:25 , ALA A:28 , SER A:29 , ARG A:32 , ASN A:33 , PHE A:49 , GLN A:51 , LEU A:63 , ASP A:70 , HIS A:73BINDING SITE FOR RESIDUE FMN A1137
2AC2SOFTWARETYR B:509 , ILE B:525 , ALA B:528 , SER B:529 , ARG B:532 , ASN B:533 , PHE B:549 , GLN B:551 , LEU B:563 , ILE B:567 , ASP B:570 , ARG B:572 , MET B:594 , HOH B:2049 , HOH B:2050BINDING SITE FOR RESIDUE FMN B1632

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2BYC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2BYC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2BYC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2BYC)

(-) Exons   (0, 0)

(no "Exon" information available for 2BYC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with Q3IYE4_RHOS4 | Q3IYE4 from UniProtKB/TrEMBL  Length:140

    Alignment length:137
                             1                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       
         Q3IYE4_RHOS4     - -MDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSKGDA 136
               SCOP domains -d2byca1 A:1-136 Blue light receptor BlrB                                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhh.eeeeee...eeeeeeeeehhhhhhhhhhhhh...eeeeeeeeeee...........eeehhhhhhhhhhhhh.......hhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2byc A   0 FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASLSRGDA 136
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       


Chain B from PDB  Type:PROTEIN  Length:132
 aligned with Q3IYE4_RHOS4 | Q3IYE4 from UniProtKB/TrEMBL  Length:140

    Alignment length:132
                             1                                                                                                                                  
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129  
         Q3IYE4_RHOS4     - -MDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASL 131
               SCOP domains d2bycb_ B: Blue light receptor BlrB                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhh.eeeeee...eeeeeeeeehhhhhhhhhhhhhh..eeeeeeeeeee...........eeehhhhhhhhhhhhh.......hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2byc B 500 FMDELVSLTYRSRVRLADPVADIVQIMRASRVRNLRLGITGILLYNGVHFVQTIEGPRSACDELFRLISADPRHQEILAFDLEPITARRFPDWSMRIVSRKELRALAPDLERLDLSGPEDVAELHRTIAASL 631
                                   509       519       529       539       549       559       569       579       589       599       609       619       629
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2BYC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BYC)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q3IYE4_RHOS4 | Q3IYE4)
molecular function
    GO:0071949    FAD binding    Interacting selectively and non-covalently with the oxidized form, FAD, of flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0009882    blue light photoreceptor activity    The function of absorbing and responding to electromagnetic radiation with a wavelength of approximately 400-470nm. The response may involve a change in conformation.
biological process
    GO:0009785    blue light signaling pathway    The series of molecular signals initiated upon sensing of blue light by photoreceptor molecule, at a wavelength between 400nm and 470nm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2byc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2byc
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q3IYE4_RHOS4 | Q3IYE4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q3IYE4_RHOS4 | Q3IYE4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2BYC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2BYC)