![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (3, 6) |
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 2BTI) |
(no "Cis Peptide Bond" information available for 2BTI) |
(no "SAP(SNP)/Variant" information available for 2BTI) |
(no "PROSITE Motif" information available for 2BTI) |
(no "Exon" information available for 2BTI) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with CSRA_PECAS | Q6D1T1 from UniProtKB/Swiss-Prot Length:61 Alignment length:59 1 | 9 19 29 39 49 CSRA_PECAS - -MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQP 58 SCOP domains d2btia_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 2bti A -1 SmLILTRRVGETLmIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQP 58 || 9 | 19 29 39 49 || 13-MSE -1| 1-MSE Chain B from PDB Type:PROTEIN Length:58 aligned with CSRA_PECAS | Q6D1T1 from UniProtKB/Swiss-Prot Length:61 Alignment length:58 1 | 8 18 28 38 48 CSRA_PECAS - --MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKS 56 SCOP domains d2btib_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 2bti B -2 GSmLILTRRVGETLmIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKS 56 || 8 | 18 28 38 48 -1| 13-MSE 1-MSE
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 2BTI) |
(no "Pfam Domain" information available for 2BTI) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CSRA_PECAS | Q6D1T1)
|
|
|
|
|
|
|