|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)| Asymmetric/Biological Unit (3, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BTI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BTI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BTI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2BTI) |
Exons (0, 0)| (no "Exon" information available for 2BTI) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:59 aligned with CSRA_PECAS | Q6D1T1 from UniProtKB/Swiss-Prot Length:61 Alignment length:59 1 | 9 19 29 39 49 CSRA_PECAS - -MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQP 58 SCOP domains d2btia_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------- Transcript 2bti A -1 SmLILTRRVGETLmIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQP 58 || 9 | 19 29 39 49 || 13-MSE -1| 1-MSE Chain B from PDB Type:PROTEIN Length:58 aligned with CSRA_PECAS | Q6D1T1 from UniProtKB/Swiss-Prot Length:61 Alignment length:58 1 | 8 18 28 38 48 CSRA_PECAS - --MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKS 56 SCOP domains d2btib_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------- Transcript 2bti B -2 GSmLILTRRVGETLmIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKS 56 || 8 | 18 28 38 48 -1| 13-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2BTI) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BTI) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CSRA_PECAS | Q6D1T1)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|