2BT2 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   STRUCTURE OF THE REGULATOR OF G-PROTEIN SIGNALING 16

Authors :   G. Bunkoczi, A. Haroniti, E. Longman, F. Niesen, M. Soundararajan, L. J F. Von Delft, D. A. Doyle, C. Arrowsmith, A. Edwards, M. Sundstrom

Date :   25 May 05 (Deposition) - 03 Jun 05 (Release) - 24 Aug 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D,E
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)

Keywords :   Gtpase Activating Protein, Signal Transduction Inhibitor, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Soundararajan, F. S. Willard, A. J. Kimple, A. P. Turnbull, L. J. Ball, G. A. Schoch, C. Gileadi, O. Y. Fedorov, E. F. Dowler, V. A. Higman, S. Q. Hutsell, M. Sundstrom, D. A. Doyle, D. P. Siderovski
Structural Diversity In The Rgs Domain And Its Interaction With Heterotrimeric G Protein Alpha- Subunits.
Proc. Natl. Acad. Sci. Usa V. 105 6457 2008
PubMed-ID: 18434541 | Reference-DOI: 10.1073/PNAS.0801508105

Molecule 1 - REGULATOR OF G-PROTEIN SIGNALING 16
	Cell	:	LYMPHOCYTE
	Chains	:	A, B, C, D, E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PLIC-SGC
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 53-190
	Organ	:	LUNG, RETINA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RGS16, RETINALLY ABUNDANT REGULATOR OF G-PROTEIN SIGNALING, RGS-R, A28-RGS14P

		1	2	3	4	5
Asymmetric Unit	:	A	B	C	D	E
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2BT2)

(no "Site" information available for 2BT2)

(no "SS Bond" information available for 2BT2)

(no "Cis Peptide Bond" information available for 2BT2)

Asymmetric Unit (1, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	A/B/C/D/E	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	A	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	B	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	C	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	D	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_046528	H	137	R	RGS16_HUMAN	Polymorphism	1144566	E	R	137	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	5	A:65-181 B:65-181 C:65-181 D:65-181 E:65-181

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	1	A:65-181 - - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	1	- B:65-181 - - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	1	- - C:65-181 - -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	1	- - - D:65-181 -

Biological Unit 5 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS16_HUMAN	65-181	1	- - - - E:65-181

Asymmetric Unit (4, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000367558	1	ENSE00001445026	chr1:182573543-182573351	193	RGS16_HUMAN	1-15	15	0	-	-
1.2	ENST00000367558	2	ENSE00000959323	chr1:182572474-182572364	111	RGS16_HUMAN	15-52	38	5	A:46-52 B:46-52 C:45-52 D:47-52 (gaps) E:45-52	7 7 8 36 8
1.3	ENST00000367558	3	ENSE00000959324	chr1:182571619-182571555	65	RGS16_HUMAN	52-74	23	5	A:52-74 B:52-74 C:52-74 D:52-74 E:52-74	23 23 23 23 23
1.4	ENST00000367558	4	ENSE00000959303	chr1:182571267-182571101	167	RGS16_HUMAN	74-129	56	5	A:74-129 B:74-129 C:74-129 D:74-129 E:74-129	56 56 56 56 56
1.5	ENST00000367558	5	ENSE00001445025	chr1:182569648-182567758	1891	RGS16_HUMAN	130-202	73	5	A:130-188 B:130-187 C:130-186 D:130-187 E:130-187	59 58 57 58 58

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:143
 aligned with RGS16_HUMAN | O15492 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:143
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185   
          RGS16_HUMAN    46 SKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAAS 188
               SCOP domains d2bt2a_ A: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------R--------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------RGS  PDB: A:65-181 UniProt: 65-181                                                                                   ------- PROSITE
           Transcript 1 (1) 1.2    ---------------------Exon 1.4  PDB: A:74-129 UniProt: 74-129                 Exon 1.5  PDB: A:130-188 UniProt: 130-202 [INCOMPLETE]      Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3  PDB: A:52-74 ------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2bt2 A  46 NLYFQSMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAAS 188
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185

Chain B from PDB  Type:PROTEIN  Length:142
 aligned with RGS16_HUMAN | O15492 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:142
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185  
          RGS16_HUMAN    46 SKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
               SCOP domains d2bt2b_ B: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------R-------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------RGS  PDB: B:65-181 UniProt: 65-181                                                                                   ------ PROSITE
           Transcript 1 (1) 1.2    ---------------------Exon 1.4  PDB: B:74-129 UniProt: 74-129                 Exon 1.5  PDB: B:130-187 UniProt: 130-202 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3  PDB: B:52-74 ----------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2bt2 B  46 NLYFQSMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185

Chain C from PDB  Type:PROTEIN  Length:142
 aligned with RGS16_HUMAN | O15492 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:142
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184  
          RGS16_HUMAN    45 GSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASA 186
               SCOP domains d2bt2c_ C: automated matches                                                                                                                   SCOP domains
               CATH domains ----------2bt2C01 C:55-86,C:167-186       2bt2C02 C:87-166 Regulator of G-protein Signalling 4, domain 2                  2bt2C01              CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------R------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------RGS  PDB: C:65-181 UniProt: 65-181                                                                                   ----- PROSITE
           Transcript 1 (1) Exon 1.2---------------------Exon 1.4  PDB: C:74-129 UniProt: 74-129                 Exon 1.5  PDB: C:130-186 UniProt: 130-202 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) -------Exon 1.3  PDB: C:52-74 ---------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2bt2 C  45 ENLYFQSMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASA 186
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184

Chain D from PDB  Type:PROTEIN  Length:141
 aligned with RGS16_HUMAN | O15492 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:171
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186 
          RGS16_HUMAN    17 KEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
               SCOP domains d2bt2                              d_ D: automated matches                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh------------------------------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------R-------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------RGS  PDB: D:65-181 UniProt: 65-181                                                                                   ------ PROSITE
           Transcript 1 (1) Exon 1.2  PDB: D:47-52 (gaps)       ---------------------Exon 1.4  PDB: D:74-129 UniProt: 74-129                 Exon 1.5  PDB: D:130-187 UniProt: 130-202 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------Exon 1.3  PDB: D:52-74 ----------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2bt2 D  47 LYFQS------------------------------MRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
                                |    -         -         -     |  56        66        76        86        96       106       116       126       136       146       156       166       176       186 
                               51                             52

Chain E from PDB  Type:PROTEIN  Length:143
 aligned with RGS16_HUMAN | O15492 from UniProtKB/Swiss-Prot  Length:202

    Alignment length:143
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184   
          RGS16_HUMAN    45 GSKHSKENRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
               SCOP domains d2bt2e_ E: automated matches                                                                                                                    SCOP domains
               CATH domains ----------2bt2E01 E:55-86,E:167-187       2bt2E02 E:87-166 Regulator of G-protein Signalling 4, domain 2                  2bt2E01               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------R-------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------RGS  PDB: E:65-181 UniProt: 65-181                                                                                   ------ PROSITE
           Transcript 1 (1) Exon 1.2---------------------Exon 1.4  PDB: E:74-129 UniProt: 74-129                 Exon 1.5  PDB: E:130-187 UniProt: 130-202 [INCOMPLETE]     Transcript 1 (1)
           Transcript 1 (2) -------Exon 1.3  PDB: E:52-74 ----------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2bt2 E  45 ENLYFQSMRNFSEDVLGWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAA 187
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Regulator of G-protein signaling, RGS (52)

Superfamily: Regulator of G-protein signaling, RGS (52)

Family: automated matches (25)

Protein domain: automated matches (25)

Human (Homo sapiens) [TaxId: 9606] (24)

1a	d2bt2a_	A:
1b	d2bt2b_	B:
1c	d2bt2c_	C:
1d	d2bt2d_	D:
1e	d2bt2e_	E:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Regulator of G-protein Signalling 4; domain 1 (15)

Homologous Superfamily: [code=1.10.196.10, no name defined] (14)

Human (Homo sapiens) (8)

1a	2bt2C01	C:55-86,C:167-186
1b	2bt2E01	E:55-86,E:167-187

Topology: Regulator of G-protein Signalling 4; domain 2 (19)

Homologous Superfamily: Regulator of G-protein Signalling 4, domain 2 (19)

Human (Homo sapiens) (11)

2a	2bt2C02	C:87-166
2b	2bt2E02	E:87-166

(no "Pfam Domain" information available for 2BT2)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E (RGS16_HUMAN | O15492)

molecular function
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	Any process that modulates the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0031224	intrinsic component of membrane	The component of a membrane consisting of the gene products having some covalently attached portion, for example part of a peptide sequence or some other covalently attached group such as a GPI anchor, which spans or is embedded in one or both leaflets of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2bt2)

	Sites
(no "Sites" information available for 2bt2)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bt2)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bt2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RGS16_HUMAN \| O15492
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RGS16_HUMAN \| O15492
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	RGS16_HUMAN \| O15492	:	2ik8

(no "Related Entries Specified in the PDB File" available for 2BT2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 5)

PROSITE Motifs (1, 5)

Exons (4, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 5)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File