2BSK - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE TIM9 TIM10 HEXAMERIC COMPLEX

Authors :   C. T. Webb, M. A. Gorman, M. Lazarus, M. T. Ryan, J. M. Gulbis

Date :   23 May 05 (Deposition) - 04 Jan 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Protein Transport, Tim9, Tim10, Mitochondrial Protein Import, Tim Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. T. Webb, M. A. Gorman, M. Lazarou, M. T. Ryan, J. M. Gulbis
Crystal Structure Of The Mitochondrial Chaperone Tim9*10 Reveals A Six-Bladed Alpha-Propeller.
Mol. Cell V. 21 123 2006
PubMed-ID: 16387659 | Reference-DOI: 10.1016/J.MOLCEL.2005.11.010

Molecule 1 - MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM9 A
	Chains	:	A, C, E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX 4T2
	Expression System Strain	:	ORIGAMI DE3 PLYSS
	Expression System Taxid	:	562
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

Molecule 2 - MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM10
	Chains	:	B, D, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX 4T2
	Expression System Strain	:	ORIGAMI DE3 PLYSS
	Expression System Taxid	:	562
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 19)

No.	Name	Count	Type	Full Name
1	MSE	19	Mod. Amino Acid	SELENOMETHIONINE

(no "Site" information available for 2BSK)

Asymmetric/Biological Unit

No.	Residues
1	A:28	-	A:52
2	A:32	-	A:48
3	B:29	-	B:54
4	B:33	-	B:50
5	C:28	-	C:52
6	C:32	-	C:48
7	D:29	-	D:54
8	D:33	-	D:50
9	E:28	-	E:52
10	E:32	-	E:48
11	F:29	-	F:54
12	F:33	-	F:50

(no "Cis Peptide Bond" information available for 2BSK)

(no "SAP(SNP)/Variant" information available for 2BSK)

(no "PROSITE Motif" information available for 2BSK)

Asymmetric/Biological Unit (5, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000257245	1b	ENSE00001027295	chr11:57298238-57298131	108	TIM10_HUMAN	-	0	0	-	-
1.2b	ENST00000257245	2b	ENSE00000916207	chr11:57297707-57297592	116	TIM10_HUMAN	1-24	24	3	B:13-24 D:1-24 F:10-24	12 24 15
1.3c	ENST00000257245	3c	ENSE00000916206	chr11:57296391-57295936	456	TIM10_HUMAN	24-90	67	3	B:24-77 D:24-90 F:24-73	54 67 50

2.1	ENST00000395159	1	ENSE00001389910	chr14:58894232-58894110	123	TIM9_HUMAN	-	0	0	-	-
2.2b	ENST00000395159	2b	ENSE00001520759	chr14:58893960-58893767	194	TIM9_HUMAN	-	0	0	-	-
2.3b	ENST00000395159	3b	ENSE00001520757	chr14:58890808-58890726	83	TIM9_HUMAN	-	0	0	-	-
2.4b	ENST00000395159	4b	ENSE00001374830	chr14:58878689-58878625	65	TIM9_HUMAN	1-13	13	3	A:13-13 C:9-13 E:13-13	1 5 1
2.5	ENST00000395159	5	ENSE00000658069	chr14:58877656-58877561	96	TIM9_HUMAN	14-45	32	3	A:14-45 C:14-45 E:14-45	32 32 32
2.6b	ENST00000395159	6b	ENSE00001520754	chr14:58875886-58875214	673	TIM9_HUMAN	46-89	44	3	A:46-85 C:46-87 E:46-75	40 42 30

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:73
 aligned with TIM9_HUMAN | Q9Y5J7 from UniProtKB/Swiss-Prot  Length:89

    Alignment length:73
                                    22        32        42        52        62        72        82   
            TIM9_HUMAN   13 QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL 85
               SCOP domains d2bska1 A:13-85                                                           SCOP domains
               CATH domains ------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------- PROSITE
               Transcript 2 2Exon 2.5  PDB: A:14-45          Exon 2.6b  PDB: A:46-85 UniProt: 46-89   Transcript 2
                  2bsk A 13 QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLL 85
                                    22        32        42        52        62        72        82

Chain B from PDB  Type:PROTEIN  Length:65
 aligned with TIM10_HUMAN | P62072 from UniProtKB/Swiss-Prot  Length:90

    Alignment length:65
                                    22        32        42        52        62        72     
           TIM10_HUMAN   13 LEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDE 77
               SCOP domains d2bskb1 B:13-77                                                   SCOP domains
               CATH domains ----------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2b   ----------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.3c  PDB: B:24-77 UniProt: 24-90 [INCOMPLETE]    Transcript 1 (2)
                  2bsk B 13 LEVEmmADmYNRmTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERmGKKLTELSmQDE 77
                                ||  22  |     32        42        52        62  |     72 |   
                                ||  |   |                                      65-MSE   74-MSE
                               17-MSE   |                                                    
                                18-MSE  |                                                    
                                   21-MSE                                                    
                                       25-MSE

Chain C from PDB  Type:PROTEIN  Length:79
 aligned with TIM9_HUMAN | Q9Y5J7 from UniProtKB/Swiss-Prot  Length:89

    Alignment length:79
                                    18        28        38        48        58        68        78         
            TIM9_HUMAN    9 DQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQ 87
               SCOP domains ----d2bskc1 C:13-85                                                          -- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
               Transcript 2 2.4b Exon 2.5  PDB: C:14-45          Exon 2.6b  PDB: C:46-87 UniProt: 46-89     Transcript 2
                  2bsk C  9 DQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQ 87
                                    18        28        38        48        58        68        78

Chain D from PDB  Type:PROTEIN  Length:90
 aligned with TIM10_HUMAN | P62072 from UniProtKB/Swiss-Prot  Length:90

    Alignment length:90
                                    10        20        30        40        50        60        70        80        90
           TIM10_HUMAN    1 MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA 90
               SCOP domains ------------d2bskd1 D:13-77                                                  ------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.2b  PDB: D:1-24  ------------------------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3c  PDB: D:24-90 UniProt: 24-90                              Transcript 1 (2)
                  2bsk D  1 mDPLRAQQLAAELEVEmmADmYNRmTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERmGKKLTELSmQDEELmKRVQQSSGPA 90
                            |       10      ||20|   |   30        40        50        60    |   70   |    80        90
                            |              17-MSE   |                                      65-MSE   74-MSE |          
                            1-MSE           18-MSE  |                                                     80-MSE      
                                               21-MSE                                                                 
                                                   25-MSE

Chain E from PDB  Type:PROTEIN  Length:63
 aligned with TIM9_HUMAN | Q9Y5J7 from UniProtKB/Swiss-Prot  Length:89

    Alignment length:63
                                    22        32        42        52        62        72   
            TIM9_HUMAN   13 QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQN 75
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
               Transcript 2 2Exon 2.5  PDB: E:14-45          Exon 2.6b  PDB: E:46-75        Transcript 2
                  2bsk E 13 QFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQN 75
                                    22        32        42        52        62        72

Chain F from PDB  Type:PROTEIN  Length:64
 aligned with TIM10_HUMAN | P62072 from UniProtKB/Swiss-Prot  Length:90

    Alignment length:64
                                    19        29        39        49        59        69    
           TIM10_HUMAN   10 AAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELS 73
               SCOP domains ---d2bskf1 F:13-73                                               SCOP domains
               CATH domains ---------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2b      ------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------Exon 1.3c  PDB: F:24-73 UniProt: 24-90             Transcript 1 (2)
                  2bsk F 10 AAELEVEmmADmYNRmTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERmGKKLTELS 73
                                   |19 |   |  29        39        49        59     |  69    
                                  17-MSE   |                                      65-MSE    
                                   18-MSE  |                                                
                                      21-MSE                                                
                                          25-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Tim10-like (3)

Superfamily: Tim10-like (3)

Family: Tim10/DDP (2)

Protein domain: Mitochondrial import inner membrane translocase subunit Tim10 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d2bskb1	B:13-77
1b	d2bskd1	D:13-77
1c	d2bskf1	F:13-73

Protein domain: Mitochondrial import inner membrane translocase subunit Tim9 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

2a	d2bska1	A:13-85
2b	d2bskc1	C:13-85

(no "CATH Domain" information available for 2BSK)

(no "Pfam Domain" information available for 2BSK)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C,E (TIM9_HUMAN | Q9Y5J7)

molecular function
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0072321	chaperone-mediated protein transport	The directed movement of proteins into, out of or within a cell, or between cells, mediated by chaperone molecules that bind to the transported proteins.
	GO:0045039	protein import into mitochondrial inner membrane	The process comprising the import of proteins into the mitochondrion from outside the organelle and their insertion into the mitochondrial inner membrane. The translocase of the outer membrane complex mediates the passage of these proteins across the outer membrane, after which they are guided by either of two inner membrane translocase complexes into their final destination in the inner membrane.
	GO:0006626	protein targeting to mitochondrion	The process of directing proteins towards and into the mitochondrion, usually mediated by mitochondrial proteins that recognize signals contained within the imported protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007605	sensory perception of sound	The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0042721	mitochondrial inner membrane protein insertion complex	A multi-subunit complex embedded in the mitochondrial inner membrane that mediates insertion of carrier proteins into the inner membrane.
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0042719	mitochondrial intermembrane space protein transporter complex	Soluble complex of the mitochondrial intermembrane space composed of various combinations of small Tim proteins; acts as a protein transporter to guide proteins to the Tim22 complex for insertion into the mitochondrial inner membrane.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain B,D,F (TIM10_HUMAN | P62072)

molecular function
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0072321	chaperone-mediated protein transport	The directed movement of proteins into, out of or within a cell, or between cells, mediated by chaperone molecules that bind to the transported proteins.
	GO:0045039	protein import into mitochondrial inner membrane	The process comprising the import of proteins into the mitochondrion from outside the organelle and their insertion into the mitochondrial inner membrane. The translocase of the outer membrane complex mediates the passage of these proteins across the outer membrane, after which they are guided by either of two inner membrane translocase complexes into their final destination in the inner membrane.
	GO:0006626	protein targeting to mitochondrion	The process of directing proteins towards and into the mitochondrion, usually mediated by mitochondrial proteins that recognize signals contained within the imported protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007605	sensory perception of sound	The series of events required for an organism to receive an auditory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Sonic stimuli are detected in the form of vibrations and are processed to form a sound.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005744	mitochondrial inner membrane presequence translocase complex	The protein transport machinery of the mitochondrial inner membrane that contains three essential Tim proteins: Tim17 and Tim23 are thought to build a preprotein translocation channel while Tim44 interacts transiently with the matrix heat-shock protein Hsp70 to form an ATP-driven import motor.
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0042719	mitochondrial intermembrane space protein transporter complex	Soluble complex of the mitochondrial intermembrane space composed of various combinations of small Tim proteins; acts as a protein transporter to guide proteins to the Tim22 complex for insertion into the mitochondrial inner membrane.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2bsk)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bsk)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2bsk
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TIM10_HUMAN \| P62072
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TIM9_HUMAN \| Q9Y5J7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TIM10_HUMAN \| P62072
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TIM9_HUMAN \| Q9Y5J7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2BSK)

(no "Related Entries Specified in the PDB File" available for 2BSK)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 19)

Sites (0, 0)

SS Bonds (12, 12)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (5, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 5)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (20, 38)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File