Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STUDY OF BROMELAIN INHIBITOR VI FROM PINEAPPLE STEM
 
Authors :  K. -I. Hatano
Date :  07 Dec 95  (Deposition) - 03 Apr 96  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  H,L  (18x)
Keywords :  Cysteine Protease Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Hatano, M. Kojima, M. Tanokura, K. Takahashi
Solution Structure Of Bromelain Inhibitor Iv From Pineapple Stem: Structural Similarity With Bowman-Birk Trypsin/Chymotrypsin Inhibitor From Soybean.
Biochemistry V. 35 5379 1996
PubMed-ID: 8611527  |  Reference-DOI: 10.1021/BI952754+
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BROMELAIN INHIBITOR VI
    ChainsL
    Organism CommonPINEAPPLE
    Organism ScientificANANAS COMOSUS
    Organism Taxid4615
    TissueSTEM
 
Molecule 2 - BROMELAIN INHIBITOR VI
    ChainsH
    Organism CommonPINEAPPLE
    Organism ScientificANANAS COMOSUS
    Organism Taxid4615
    TissueSTEM

 Structural Features

(-) Chains, Units

  
NMR Structure (18x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2BI6)

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1B1UNKNOWNLEU L:10 , ARG L:11NULL

(-) SS Bonds  (5, 5)

NMR Structure
No.Residues
1H:14 -H:21
2H:18 -H:30
3L:3 -H:7
4L:6 -H:39
5L:8 -H:5

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2BI6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

NMR Structure (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_IBRO_ANACO_001 *E188QIBRO_ANACO  ---  ---HE1Q
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2BI6)

(-) Exons   (0, 0)

(no "Exon" information available for 2BI6)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain H from PDB  Type:PROTEIN  Length:41
 aligned with IBRO_ANACO | P01068 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:41
                                   197       207       217       227 
           IBRO_ANACO   188 EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK 228
               SCOP domains d2bi6.2d2bi6h1 H:8-31          d2bi6.2    SCOP domains
               CATH domains 2bi6H00 H:1-41                            CATH domains
               Pfam domains ----------------------------------------- Pfam domains
         Sec.struct. author ....eee.eee..........eee..eee..eee....... Sec.struct. author
                 SAPs(SNPs) Q---------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------- PROSITE
                 Transcript ----------------------------------------- Transcript
                 2bi6 H   1 EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK  41
                                    10        20        30        40 

Chain L from PDB  Type:PROTEIN  Length:11
 aligned with IBRO_ANACO | P01068 from UniProtKB/Swiss-Prot  Length:246

    Alignment length:11
                                   181 
           IBRO_ANACO   172 TACSECVCPLR 182
               SCOP domains d2bi6.2     SCOP domains
               CATH domains ----------- CATH domains
               Pfam domains ----------- Pfam domains
         Sec.struct. author .....eee... Sec.struct. author
                 SAPs(SNPs) ----------- SAPs(SNPs)
                    PROSITE ----------- PROSITE
                 Transcript ----------- Transcript
                 2bi6 L   1 TACSECVCPLR  11
                                    10 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2BI6)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain H,L   (IBRO_ANACO | P01068)
molecular function
    GO:0030414    peptidase inhibitor activity    Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0010466    negative regulation of peptidase activity    Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2bi6)
 
  Sites
    B1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2bi6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2bi6
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IBRO_ANACO | P01068
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  IBRO_ANACO | P01068
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IBRO_ANACO | P010681bi6

(-) Related Entries Specified in the PDB File

1bi6