|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2BH5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2BH5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2BH5) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2BH5) |
Sequences/Alignments
Asymmetric/Biological UnitChain X from PDB Type:PROTEIN Length:122 aligned with CY550_PARVE | Q00499 from UniProtKB/Swiss-Prot Length:154 Alignment length:122 31 41 51 61 71 81 91 101 111 121 131 141 CY550_PARVE 22 EGDAAKGEKEFNKCKACHMVQAPDGTDIVKGGKTGPNLYGVVGRKIASVEGFKYGDGILEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSAAKTKMTFKLGKNQADVVAFLAQHSPDAG 143 SCOP domains d2bh5x_ X: automated matches SCOP domains CATH domains 2bh5X00 X:2-123 Cytochrome c CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTC PDB: X:3-119 UniProt: 23-139 ---- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2bh5 X 2 EGDAAKGEKEFNKCKACHMVQAPDGTDIVKGGKTGPNLYGVVGRKIASVEGFKYGDGILEVAEKNPDMVWSEADLIEYVTDPKPWLVEKTGDSAAKTKKTFKLGKNQADVVAFLAQHSPDAG 123 11 21 31 41 51 61 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2BH5) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain X (CY550_PARVE | Q00499)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|