2BB2 - JenaLib

Title :   X-RAY ANALYSIS OF BETA B2-CRYSTALLIN AND EVOLUTION OF OLIGOMERIC LENS PROTEINS

Authors :   B. Bax, R. Lapatto, V. Nalini, H. Driessen, P. F. Lindley, D. Mahadevan, T. L. Blundell, C. Slingsby

Date :   21 Sep 92 (Deposition) - 31 Oct 93 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A
Biol. Unit 1: A  (4x)
Biol. Unit 2: A  (2x)

Keywords :   Eye Lens Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   B. Bax, R. Lapatto, V. Nalini, H. Driessen, P. F. Lindley, D. Mahadevan T. L. Blundell, C. Slingsby
X-Ray Analysis Of Beta B2-Crystallin And Evolution Of Oligomeric Lens Proteins.
Nature V. 347 776 1990
PubMed-ID: 2234050 | Reference-DOI: 10.1038/347776A0
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_BOVIN	17-56 57-101 107-148 149-191	4	A:1-39 A:40-82 A:88-128 A:129-171

Biological Unit 1 (1, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_BOVIN	17-56 57-101 107-148 149-191	16	A:1-39 A:40-82 A:88-128 A:129-171

Biological Unit 2 (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CRYSTALLIN_BETA_GAMMA	PS50915	Crystallins beta and gamma 'Greek key' motif profile.	CRBB2_BOVIN	17-56 57-101 107-148 149-191	8	A:1-39 A:40-82 A:88-128 A:129-171

Exons (5, 5)

Asymmetric Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSBTAT00000005341	1	ENSBTAE00000303238	chr17:68751799-68751827	29	CRBB2_BOVIN	-	0	0	-	-
1.2	ENSBTAT00000005341	2	ENSBTAE00000303236	chr17:68753534-68753613	80	CRBB2_BOVIN	1-18	18	1	A:-2-2	4
1.3	ENSBTAT00000005341	3	ENSBTAE00000042936	chr17:68756373-68756491	119	CRBB2_BOVIN	19-58	40	1	A:3-41	40
1.4	ENSBTAT00000005341	4	ENSBTAE00000042937	chr17:68759011-68759143	133	CRBB2_BOVIN	58-102	45	1	A:41-83	45
1.5	ENSBTAT00000005341	5	ENSBTAE00000042939	chr17:68760407-68760549	143	CRBB2_BOVIN	103-150	48	1	A:84-130 (gaps)	49
1.6	ENSBTAT00000005341	6	ENSBTAE00000042940	chr17:68762377-68762636	260	CRBB2_BOVIN	150-205	56	1	A:130-175	46

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:181
 aligned with CRBB2_BOVIN | P02522 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:181
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194 
         CRBB2_BOVIN     15 LNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKITLYENPNFTGKKMEVIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSGDFGAPQPQVQSVRRIRDMQW  195
               SCOP domains d2bb2a1 A:-2-85 beta-Crystallin                                                           d2bb2a2 A:86-175 beta-Crystallin                                                            SCOP domains
               CATH domains --2bb2A01 A:1-83 Crystallins                                                            2bb2A02 A:84-174 Crystallins                                                                - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee...eeeeeee.....hhhhhh.....eeeeee..eeeeee...eeeeeee..eee.hhhhh..........eeee........eeeeeee...eeeeeeee......hhhhh......eeee....eeeeee...eeeeeee..eee.hhhhhh.......eeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --CRYSTALLIN_BETA_GAMMA  PDB: A:1-39      CRYSTALLIN_BETA_GAMMA  PDB: A:40-82          -----CRYSTALLIN_BETA_GAMMA  PDB: A:88-128      CRYSTALLIN_BETA_GAMMA  PDB: A:129-171      ---- PROSITE
           Transcript 1 (1) 1.2 Exon 1.3  PDB: A:3-41 UniProt: 19-58    --------------------------------------------Exon 1.5  PDB: A:84-130 (gaps) UniProt: 103-150 --------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.4  PDB: A:41-83 UniProt: 58-102       -----------------------------------------------Exon 1.6  PDB: A:130-175 UniProt: 150-205      Transcript 1 (2)
                2bb2 A   -2 LNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKITLYENPNFTGKKMEVIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSGDFGAPQPQVQSVRRIRDMQW  175
                             ||      8        18        28|       37        47        57        67   | |  75        85        95       105 |     114|  |   124       134       144       154       164       174 
                             ||                         28A                                        70A |                                106A     114|  |                                                         
                            -1|                                                                      71A                                          116  |                                                         
                              1                                                                                                                     118A

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Asymmetric Unit(hide GO term definitions)

Chain A (CRBB2_BOVIN | P02522)

molecular function
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0005212	structural constituent of eye lens	The action of a molecule that contributes to the structural integrity of the lens of an eye.
biological process
	GO:0043010	camera-type eye development	The process whose specific outcome is the progression of the camera-type eye over time, from its formation to the mature structure. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BME	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:40 - Pro A:41	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2bb2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CRBB2_BOVIN \| P02522
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CRBB2_BOVIN \| P02522
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description