|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 6) Biological Unit 2 (1, 1) Biological Unit 3 (1, 3) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2B33) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2B33) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2B33) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2B33) |
Exons (0, 0)| (no "Exon" information available for 2B33) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:127 aligned with Q9WY58_THEMA | Q9WY58 from UniProtKB/TrEMBL Length:128 Alignment length:127 10 20 30 40 50 60 70 80 90 100 110 120 Q9WY58_THEMA 1 MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG 127 SCOP domains -d2b33a1 A:2-127 Putative protein synthesis inhibitor TM0215 SCOP domains CATH domains 2b33A00 A:1-127 [code=3.30.1330.40, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript 2b33 A 1 MKRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG 127 10 20 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:126 aligned with Q9WY58_THEMA | Q9WY58 from UniProtKB/TrEMBL Length:128 Alignment length:126 11 21 31 41 51 61 71 81 91 101 111 121 Q9WY58_THEMA 2 KRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG 127 SCOP domains d2b33b_ B: Putative protein synthesis inhibitor TM0215 SCOP domains CATH domains 2b33B00 B:2-127 [code=3.30.1330.40, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 2b33 B 2 KRFVETDKAPKAIGPYSQAVVVGNMMFVSGQIPIDPETGELVQGTIEEKTERVLENLKAILEAGGFSLKDVVKVTVFTTSMDYFQRVNEVYSRYFGDHRPARSFVAVAQLPRNVEIEIEAIAVKEG 127 11 21 31 41 51 61 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2B33) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2B33)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|