2AYN - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   STRUCTURE OF USP14, A PROTEASOME-ASSOCIATED DEUBIQUITINATING ENZYME

Authors :   M. Hu, P. Li, P. D. Jeffrey, Y. Shi

Date :   07 Sep 05 (Deposition) - 18 Oct 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.20

Chains :   Asym./Biol. Unit : A,B,C

Keywords :   Deubiquitinating Enzymes, Dub, Usp14, Proteasome, Enzyme Mechanism, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Hu, P. Li, L. Song, P. D. Jeffrey, T. A. Chenova, K. D. Wilkinson, R. E. Cohen, Y. Shi
Structure And Mechanisms Of The Proteasome-Associated Deubiquitinating Enzyme Usp14.
Embo J. V. 24 3747 2005
PubMed-ID: 16211010 | Reference-DOI: 10.1038/SJ.EMBOJ.7600832
(for further references see the PDB file header)

Molecule 1 - UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 14
	Chains	:	A, B, C
	EC Number	:	3.1.2.15
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PGEX-2T
	Expression System Vector Type	:	PLASMID
	Gene	:	USP14, TGT
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	UBIQUITIN THIOLESTERASE 14, UBIQUITIN-SPECIFIC PROCESSING PROTEASE 14, DEUBIQUITINATING ENZYME 14

		1	2	3
Asymmetric/Biological Unit	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2AYN)

(no "Site" information available for 2AYN)

(no "SS Bond" information available for 2AYN)

(no "Cis Peptide Bond" information available for 2AYN)

(no "SAP(SNP)/Variant" information available for 2AYN)

Asymmetric/Biological Unit (3, 9)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	USP_3	PS50235	Ubiquitin specific protease (USP) domain profile.	UBP14_HUMAN	105-483	3	A:104-482 B:104-482 C:104-482
2	USP_1	PS00972	Ubiquitin specific protease (USP) domain signature 1.	UBP14_HUMAN	106-121	3	A:105-120 B:105-120 C:105-120
3	USP_2	PS00973	Ubiquitin specific protease (USP) domain signature 2.	UBP14_HUMAN	418-436	3	A:417-435 B:417-435 C:417-435

Asymmetric/Biological Unit (12, 36)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000261601	1b	ENSE00001208684	chr18:158483-158714	232	UBP14_HUMAN	1-6	6	0	-	-
1.2	ENST00000261601	2	ENSE00001208695	chr18:163308-163453	146	UBP14_HUMAN	6-54	49	0	-	-
1.3	ENST00000261601	3	ENSE00001208679	chr18:166787-166819	33	UBP14_HUMAN	55-65	11	0	-	-
1.4	ENST00000261601	4	ENSE00001208675	chr18:178933-179037	105	UBP14_HUMAN	66-100	35	0	-	-
1.5	ENST00000261601	5	ENSE00000948455	chr18:180236-180339	104	UBP14_HUMAN	101-135	35	3	A:100-134 B:100-134 C:100-134	35 35 35
1.6	ENST00000261601	6	ENSE00000799430	chr18:192842-192900	59	UBP14_HUMAN	135-155	21	3	A:134-154 (gaps) B:134-154 (gaps) C:134-154 (gaps)	21 21 21
1.7	ENST00000261601	7	ENSE00001208659	chr18:196637-196767	131	UBP14_HUMAN	155-198	44	3	A:154-197 B:154-197 C:154-197	44 44 44
1.8	ENST00000261601	8	ENSE00000799432	chr18:197616-197696	81	UBP14_HUMAN	199-225	27	3	A:198-220 B:198-220 C:198-220	23 23 23
1.9	ENST00000261601	9	ENSE00000664590	chr18:198047-198132	86	UBP14_HUMAN	226-254	29	3	A:239-253 B:239-253 C:239-253	15 15 15
1.10	ENST00000261601	10	ENSE00000664627	chr18:199202-199316	115	UBP14_HUMAN	254-292	39	3	A:253-291 B:253-291 C:253-291	39 39 39
1.11	ENST00000261601	11	ENSE00000799435	chr18:202880-202945	66	UBP14_HUMAN	293-314	22	3	A:292-313 B:292-313 C:292-313	22 22 22
1.12	ENST00000261601	12	ENSE00000799436	chr18:203098-203190	93	UBP14_HUMAN	315-345	31	3	A:314-344 B:314-344 C:314-344	31 31 31
1.13	ENST00000261601	13	ENSE00000799437	chr18:204564-204692	129	UBP14_HUMAN	346-388	43	3	A:345-378 B:345-378 C:345-378	34 34 34
1.14	ENST00000261601	14	ENSE00001252715	chr18:209971-210031	61	UBP14_HUMAN	389-409	21	3	A:401-408 B:401-408 C:401-408	8 8 8
1.15	ENST00000261601	15	ENSE00000799439	chr18:210386-210493	108	UBP14_HUMAN	409-445	37	3	A:408-444 B:408-444 C:408-444	37 37 37
1.16	ENST00000261601	16	ENSE00001208689	chr18:211133-213739	2607	UBP14_HUMAN	445-494	50	3	A:444-482 B:444-482 C:444-482	39 39 39

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:337
 aligned with UBP14_HUMAN | P54578 from UniProtKB/Swiss-Prot  Length:494

    Alignment length:383
                                   110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
          UBP14_HUMAN   101 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 483
               SCOP domains d2ayna1 A:100-482 Ubiquitin carboxyl-ter      minal hydrolase 14                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee.....hhhhhhhhhhhhhhhhhhhhhhh.....------hhhhhhhhhhhhhhhhhhhhh.ee.hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh........------------------.hhhhhhh.eeeeeeeee...........eeee..eeee......hhhhhhhhh.ee....ee....ee..eeeeeeeee....eeeeee......................eee.hhhhhhhhhhhh...hhhhh....----------------------...............eeeeeeeeeee.......eeeeeeeee..eeeee........hhhhhhhhhh.....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----USP_3  PDB: A:104-482 UniProt: 105-483                                                                                                                                                                                                                                                                                                                                                      PROSITE (1)
                PROSITE (2) -----USP_1           --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------USP_2              ----------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: A:100-134           -------------------Exon 1.7  PDB: A:154-197 UniProt: 155-198   Exon 1.8  PDB: A:198-220   ----------------------------Exon 1.10  PDB: A:253-291              Exon 1.11             Exon 1.12  PDB: A:314-344      Exon 1.13  PDB: A:345-378 UniProt: 346-388 Exon 1.14            -----------------------------------Exon 1.16  PDB: A:444-482 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.6             ----------------------------------------------------------------------Exon 1.9  PDB: A:239-253     ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: A:408-444            -------------------------------------- Transcript 1 (2)
                 2ayn A 100 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL------ASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDD------------------KSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLED----------------------EPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 482
                                   109       119       129       139      |149       159       169       179       189       199       209       219|        -       239       249       259       269       279       289       299       309       319       329       339       349       359       369        |-         -         - |     409       419       429       439       449       459       469       479   
                                                                 139    146                                                                       220                239                                                                                                                                        378                    401

Chain B from PDB  Type:PROTEIN  Length:337
 aligned with UBP14_HUMAN | P54578 from UniProtKB/Swiss-Prot  Length:494

    Alignment length:383
                                   110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
          UBP14_HUMAN   101 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 483
               SCOP domains d2aynb1 B:100-482 Ubiquitin carboxyl-ter      minal hydrolase 14                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee.....hhhhhhhhhhhhhhhhhhhhhhh.....------hhhhhhhhhhhhhhhhhh....ee.hhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhh........------------------..hhhhhh.eeeeeeeee...........eeee.eeeee......hhhhhhhhh.ee..............eeeeeeeee....eeeeee......................eee.hhhhhhhhhhhh...hhhhh....----------------------...............eeeeeeeeeee.......eeeeeeeee..eeeee........hhhhhhhhhh.....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----USP_3  PDB: B:104-482 UniProt: 105-483                                                                                                                                                                                                                                                                                                                                                      PROSITE (1)
                PROSITE (2) -----USP_1           --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------USP_2              ----------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: B:100-134           -------------------Exon 1.7  PDB: B:154-197 UniProt: 155-198   Exon 1.8  PDB: B:198-220   ----------------------------Exon 1.10  PDB: B:253-291              Exon 1.11             Exon 1.12  PDB: B:314-344      Exon 1.13  PDB: B:345-378 UniProt: 346-388 Exon 1.14            -----------------------------------Exon 1.16  PDB: B:444-482 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.6             ----------------------------------------------------------------------Exon 1.9  PDB: B:239-253     ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: B:408-444            -------------------------------------- Transcript 1 (2)
                 2ayn B 100 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL------ASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDD------------------KSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLED----------------------EPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 482
                                   109       119       129       139      |149       159       169       179       189       199       209       219|        -       239       249       259       269       279       289       299       309       319       329       339       349       359       369        |-         -         - |     409       419       429       439       449       459       469       479   
                                                                 139    146                                                                       220                239                                                                                                                                        378                    401

Chain C from PDB  Type:PROTEIN  Length:337
 aligned with UBP14_HUMAN | P54578 from UniProtKB/Swiss-Prot  Length:494

    Alignment length:383
                                   110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480   
          UBP14_HUMAN   101 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 483
               SCOP domains d2aync1 C:100-482 Ubiquitin carboxyl-ter      minal hydrolase 14                                                                                                                                                                                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee.....hhhhhhhhhhhhhhhhhhhhhhh.....------hhhhhhhhhhhhhhhhhhhhh.ee.hhhhhhhhhhhh...............hhhhhhhhhhhhhhh........------------------.hhhhhhhheeeeeeeee...........eeee.eeee.......hhhhhhhhh.ee..............eeeeeeeee....eeeee.......................eee.hhhhhhhhhhhh..hhhhhh....----------------------...............eeeeeeeeeee.......eeeeeeeee..eeeee........hhhhhhhhhh.....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----USP_3  PDB: C:104-482 UniProt: 105-483                                                                                                                                                                                                                                                                                                                                                      PROSITE (1)
                PROSITE (2) -----USP_1           --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------USP_2              ----------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: C:100-134           -------------------Exon 1.7  PDB: C:154-197 UniProt: 155-198   Exon 1.8  PDB: C:198-220   ----------------------------Exon 1.10  PDB: C:253-291              Exon 1.11             Exon 1.12  PDB: C:314-344      Exon 1.13  PDB: C:345-378 UniProt: 346-388 Exon 1.14            -----------------------------------Exon 1.16  PDB: C:444-482 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.6             ----------------------------------------------------------------------Exon 1.9  PDB: C:239-253     ----------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.15  PDB: C:408-444            -------------------------------------- Transcript 1 (2)
                 2ayn C 100 MELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL------ASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDD------------------KSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLED----------------------EPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPR 482
                                   109       119       129       139      |149       159       169       179       189       199       209       219|        -       239       249       259       269       279       289       299       309       319       329       339       349       359       369        |-         -         - |     409       419       429       439       449       459       469       479   
                                                                 139    146                                                                       220                239                                                                                                                                        378                    401

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Cysteine proteinases (392)

Superfamily: Cysteine proteinases (392)

Family: Ubiquitin carboxyl-terminal hydrolase, UCH (14)

Protein domain: Ubiquitin carboxyl-terminal hydrolase 14 (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d2ayna1	A:100-482
1b	d2aynb1	B:100-482
1c	d2aync1	C:100-482

(no "CATH Domain" information available for 2AYN)

(no "Pfam Domain" information available for 2AYN)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C (UBP14_HUMAN | P54578)

molecular function
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0004866	endopeptidase inhibitor activity	Stops, prevents or reduces the activity of an endopeptidase, any enzyme that hydrolyzes nonterminal peptide bonds in polypeptides.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0070628	proteasome binding	Interacting selectively and non-covalently with a proteasome, a large multisubunit protein complex that catalyzes protein degradation.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008193	tRNA guanylyltransferase activity	Catalysis of the posttranscriptional addition of a guanyl residue to the 5' end of a tRNA molecule; observed for His tRNAs.
	GO:0004843	thiol-dependent ubiquitin-specific protease activity	Catalysis of the thiol-dependent hydrolysis of a peptide bond formed by the C-terminal glycine of ubiquitin and another protein.
	GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	Catalysis of the thiol-dependent hydrolysis of an ester, thioester, amide, peptide or isopeptide bond formed by the C-terminal glycine of ubiquitin.
biological process
	GO:0007268	chemical synaptic transmission	The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
	GO:1903070	negative regulation of ER-associated ubiquitin-dependent protein catabolic process	Any process that stops, prevents or reduces the frequency, rate or extent of ER-associated ubiquitin-dependent protein catabolic process.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0016579	protein deubiquitination	The removal of one or more ubiquitin groups from a protein.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0050920	regulation of chemotaxis	Any process that modulates the frequency, rate or extent of the directed movement of a motile cell or organism in response to a specific chemical concentration gradient.
	GO:0061136	regulation of proteasomal protein catabolic process	Any process that modulates the rate, frequency, or extent of the chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome.
	GO:0006511	ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0000502	proteasome complex	A large multisubunit complex which catalyzes protein degradation, found in eukaryotes, archaea and some bacteria. In eukaryotes, this complex consists of the barrel shaped proteasome core complex and one or two associated proteins or complexes that act in regulating entry into or exit from the core.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ayn)

	Sites
(no "Sites" information available for 2ayn)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ayn)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ayn
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UBP14_HUMAN \| P54578
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.2.15
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UBP14_HUMAN \| P54578
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	UBP14_HUMAN \| P54578	:	2ayo 5gjq

(no "Related Entries Specified in the PDB File" available for 2AYN)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 9)

Exons (12, 36)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (25, 25)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File