Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A UBIQUINONE/MENAQUINONE BIOSYNTHESIS METHYLTRANSFERASE-RELATED PROTEIN (TM1389) FROM THERMOTOGA MARITIMA MSB8 AT 2.35 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  30 Aug 05  (Deposition) - 18 Oct 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Keywords :  Ubiquinone/Menaquinone Biosynthesis Methyltransferase-Related Protein, Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi-2, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Joint Center For Structural Genomics (Jcsg)
Crystal Structure Of Ubiquinone/Menaquinone Biosynthesis Methyltransferase-Related Protein (Tm1389) From Thermotoga Maritima At 2. 35 A Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UBIQUINONE/MENAQUINONE BIOSYNTHESIS METHYLTRANSFERASE- RELATED PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidHK100
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneTM1389
    Organism ScientificTHERMOTOGA MARITIMA
    Organism Taxid243274
    StrainMSB8

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 13)

Asymmetric Unit (3, 13)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
2PO41Ligand/IonPHOSPHATE ION
3SAI2Ligand/IonS-ADENOSYL-L-HOMOSELENOCYSTEINE
Biological Unit 1 (3, 13)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
2PO41Ligand/IonPHOSPHATE ION
3SAI2Ligand/IonS-ADENOSYL-L-HOMOSELENOCYSTEINE
Biological Unit 2 (3, 26)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE
2PO42Ligand/IonPHOSPHATE ION
3SAI4Ligand/IonS-ADENOSYL-L-HOMOSELENOCYSTEINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:210 , ARG A:214 , HOH A:1303 , HOH A:1330 , ALA B:155 , TRP B:156BINDING SITE FOR RESIDUE PO4 A 249
2AC2SOFTWARESER A:5 , TYR A:9 , TYR A:16 , GLY A:50 , GLY A:51 , GLY A:52 , ASP A:71 , PRO A:72 , SER A:73 , LYS A:92 , ALA A:93 , GLU A:94 , LEU A:109 , GLY A:110 , VAL A:112 , TYR A:115 , HOH A:1305 , HOH A:1308 , HOH A:1318 , HOH A:1379 , HOH A:1380BINDING SITE FOR RESIDUE SAI A 1300
3AC3SOFTWARESER B:5 , TYR B:9 , TYR B:16 , GLY B:50 , GLY B:51 , GLY B:52 , ASP B:71 , PRO B:72 , SER B:73 , MSE B:76 , LYS B:92 , ALA B:93 , GLU B:94 , LEU B:109 , GLY B:110 , VAL B:112 , TYR B:115 , HOH B:2307 , HOH B:2314 , HOH B:2353 , HOH B:2365BINDING SITE FOR RESIDUE SAI B 2300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2AVN)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2AVN)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2AVN)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2AVN)

(-) Exons   (0, 0)

(no "Exon" information available for 2AVN)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:247
 aligned with Q9X1A9_THEMA | Q9X1A9 from UniProtKB/TrEMBL  Length:248

    Alignment length:247
                             1                                                                                                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       
         Q9X1A9_THEMA     - -MKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR 246
               SCOP domains -d2avna1 A:1-246 Hypothetical methyltransferase TM1389                                                                                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee....hhhhhhhhh...eeeeee.hhhhhhhhhhhh...eee............eeeeee..hhhhhh.hhhhhhhhhhhheeeeeeeeeeeehhhhhhhhhhhh.hhhhhhhhhhhheeeee...eeeeee..hhhhhh....eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2avn A   0 HmKLRSWEFYDRIARAYDSmYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEmLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQmIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVmEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR 246
                             |       9        19        29        39        49        59        69      | 79        89        99       109       119       129       139       149|      159       169       179       189       199    |  209       219       229       239       
                             |                19-MSE                                                   76-MSE                                                                   150-MSE                                               204-MSE                                      
                             1-MSE                                                                                                                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:247
 aligned with Q9X1A9_THEMA | Q9X1A9 from UniProtKB/TrEMBL  Length:248

    Alignment length:247
                             1                                                                                                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       
         Q9X1A9_THEMA     - -MKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR 246
               SCOP domains d2avnb_ B: Hypothetical methyltransferase TM1389                                                                                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh....eeeee....hhhhhhhhhh..eeeee..hhhhhhhhhhhh...ee.............eeeeee..hhhhhh.hhhhhhhhhhhheeeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhhhheeeee...eeeeee..hhhhhh....eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhh...hhhhh.eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2avn B   0 HmKLRSWEFYDRIARAYDSmYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEmLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQmIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVmEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR 246
                             |       9        19        29        39        49        59        69      | 79        89        99       109       119       129       139       149|      159       169       179       189       199    |  209       219       229       239       
                             1-MSE            19-MSE                                                   76-MSE                                                                   150-MSE                                               204-MSE                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2AVN)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AVN)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q9X1A9_THEMA | Q9X1A9)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2avn)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2avn
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9X1A9_THEMA | Q9X1A9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9X1A9_THEMA | Q9X1A9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2AVN)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2AVN)