2AVD - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN CATECHOL-O-METHYLTRANSFERASE DOMAIN CONTAINING 1

Authors :   J. R. Min, H. Wu, H. Zeng, P. Loppnau, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (Sgc)

Date :   29 Aug 05 (Deposition) - 13 Sep 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A,B

Keywords :   Methyltransferase, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. R. Min, H. Wu, H. Zeng, P. Loppnau, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, A. N. Plotnikov
The Crystal Structure Of Human Catechol-O-Methyltransferase Domain Containing 1 In Complex With S-Adenosyl-L-Methionine
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CATECHOL-O-METHYLTRANSFERASE
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cell Line	:	BD FUSION-BLUE
	Expression System Plasmid	:	PET28A-LIC
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	SAM	2	Ligand/Ion	S-ADENOSYLMETHIONINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:84 , MET A:85 , MET A:86 , GLY A:110 , PHE A:112 , SER A:116 , CYS A:133 , GLU A:134 , VAL A:135 , PRO A:162 , ALA A:163 , ASP A:185 , ALA A:186 , ASP A:187 , TYR A:194 , ARG A:212 , HOH A:502 , HOH A:510 , HOH A:524 , HOH A:543 , HOH A:592 , HOH A:593 , HOH A:669 , HOH A:750	BINDING SITE FOR RESIDUE SAM A 501
2	AC2	SOFTWARE	GLU A:169 , SER B:84 , MET B:85 , MET B:86 , GLY B:110 , THR B:111 , PHE B:112 , TYR B:115 , SER B:116 , GLU B:134 , VAL B:135 , ALA B:163 , ASP B:185 , ALA B:186 , ASP B:187 , TYR B:194 , ARG B:212 , HOH B:605 , HOH B:612 , HOH B:630 , HOH B:653 , HOH B:776	BINDING SITE FOR RESIDUE SAM B 601

(no "SS Bond" information available for 2AVD)

(no "Cis Peptide Bond" information available for 2AVD)

(no "SAP(SNP)/Variant" information available for 2AVD)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_OMT_I	PS51682	SAM-dependent O-methyltransferase class I-type profile.	CMTD1_HUMAN	45-262	2	A:45-262 B:45-262

Asymmetric/Biological Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000372538	1b	ENSE00001458062	chr10:76995769-76995593	177	CMTD1_HUMAN	1-32	32	0	-	-
1.1f	ENST00000372538	1f	ENSE00001094999	chr10:76995501-76995374	128	CMTD1_HUMAN	32-74	43	2	A:44-74 B:44-74	31 31
1.1j	ENST00000372538	1j	ENSE00001095092	chr10:76995130-76995025	106	CMTD1_HUMAN	75-110	36	2	A:75-110 B:75-110	36 36
1.2a	ENST00000372538	2a	ENSE00001095050	chr10:76994936-76994818	119	CMTD1_HUMAN	110-149	40	2	A:110-149 B:110-149	40 40
1.2c	ENST00000372538	2c	ENSE00001095039	chr10:76994750-76994696	55	CMTD1_HUMAN	150-168	19	2	A:150-168 B:150-168	19 19
1.3a	ENST00000372538	3a	ENSE00001095074	chr10:76994501-76994368	134	CMTD1_HUMAN	168-212	45	2	A:168-212 B:168-212	45 45
1.4d	ENST00000372538	4d	ENSE00001928983	chr10:76993983-76993727	257	CMTD1_HUMAN	213-262	50	2	A:213-262 B:213-262	50 50

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:219
 aligned with CMTD1_HUMAN | Q86VU5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:219
                                    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253         
          CMTD1_HUMAN    44 QCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI 262
               SCOP domains d2avda1 A:44-262 COMT domain-containing protein 1, COMTD1                                                                                                                                                                   SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh....hhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhh.....eeeeee..hhhhhhhhhhhhhh.....eeeee.hhhhhhhhhhhh.....eeeeee.....hhhhhhhhhhhheeeeeeeeee..hhhhhhhh....hhhhhhhhhhhhhhhhh..eeeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SAM_OMT_I  PDB: A:45-262 UniProt: 45-262                                                                                                                                                                                   PROSITE
           Transcript 1 (1) Exon 1.1f  PDB: A:44-74        Exon 1.1j  PDB: A:75-110            ---------------------------------------Exon 1.2c          --------------------------------------------Exon 1.4d  PDB: A:213-262 UniProt: 213-262         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.2a  PDB: A:110-149               ------------------Exon 1.3a  PDB: A:168-212 UniProt: 168-212   -------------------------------------------------- Transcript 1 (2)
                 2avd A  44 QCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI 262
                                    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253

Chain B from PDB  Type:PROTEIN  Length:219
 aligned with CMTD1_HUMAN | Q86VU5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:219
                                    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253         
          CMTD1_HUMAN    44 QCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI 262
               SCOP domains d2avdb_ B: automated matches                                                                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh....hhhhhhhhhhhh...hhhhh.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhh....eeeeee..hhhhhhhhhhhhhh.hhh.eeeee.hhhhhhhhhhhh.....eeeeee.....hhhhhhhhhhhheeeeeeeeee..hhhhhhhh....hhhhhhhhhhhhhhhhh..eeeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SAM_OMT_I  PDB: B:45-262 UniProt: 45-262                                                                                                                                                                                   PROSITE
           Transcript 1 (1) Exon 1.1f  PDB: B:44-74        Exon 1.1j  PDB: B:75-110            ---------------------------------------Exon 1.2c          --------------------------------------------Exon 1.4d  PDB: B:213-262 UniProt: 213-262         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.2a  PDB: B:110-149               ------------------Exon 1.3a  PDB: B:168-212 UniProt: 168-212   -------------------------------------------------- Transcript 1 (2)
                 2avd B  44 QCLLPPEDSRLWQYLLSRSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIQAKKALDLGTFTGYSALALALALPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELLAAGEAGTFDVAVVDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLGDGLTLAFKI 262
                                    53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2AVD)

(no "Pfam Domain" information available for 2AVD)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CMTD1_HUMAN | Q86VU5)

molecular function
	GO:0008171	O-methyltransferase activity	Catalysis of the transfer of a methyl group to the oxygen atom of an acceptor molecule.
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SAM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2avd)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2avd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CMTD1_HUMAN \| Q86VU5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CMTD1_HUMAN \| Q86VU5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2AVD)

(no "Related Entries Specified in the PDB File" available for 2AVD)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File