2AUG - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE GRB14 SH2 DOMAIN

Authors :   R. S. Depetris, J. Hu, I. Gimpelevich, L. J. Holt, R. J. Daly, S. R. Hubbard

Date :   27 Aug 05 (Deposition) - 01 Nov 05 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (2x)
Biol. Unit 2: B  (2x)

Keywords :   Phosphorylation, Sh2 Domain, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. S. Depetris, J. Hu, I. Gimpelevich, L. J. Holt, R. J. Daly, S. R. Hubbard
Structural Basis For Inhibition Of The Insulin Receptor By The Adaptor Protein Grb14.
Mol. Cell V. 20 325 2005
PubMed-ID: 16246733 | Reference-DOI: 10.1016/J.MOLCEL.2005.09.001
(for further references see the PDB file header)

Molecule 1 - GROWTH FACTOR RECEPTOR-BOUND PROTEIN 14
	Chains	:	A, B
	Fragment	:	SH2 DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GRB14 ADAPTOR PROTEIN

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A
Biological Unit 2 (2x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2AUG)

(no "Site" information available for 2AUG)

(no "SS Bond" information available for 2AUG)

Asymmetric Unit

No.	Residues
1	Asn A:471	-	Pro A:472
2	Asn B:471	-	Pro B:472

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065759	H	507	Y	GRB14_HUMAN	Polymorphism	144301087	A/B	H	507	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065759	H	507	Y	GRB14_HUMAN	Polymorphism	144301087	A	H	507	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_065759	H	507	Y	GRB14_HUMAN	Polymorphism	144301087	B	H	507	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	GRB14_HUMAN	439-535	2	A:439-535 B:439-535

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	GRB14_HUMAN	439-535	2	A:439-535 -

Biological Unit 2 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SH2	PS50001	Src homology 2 (SH2) domain profile.	GRB14_HUMAN	439-535	2	- B:439-535

Asymmetric Unit (4, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000263915	1a	ENSE00001193732	chr2:165478358-165477629	730	GRB14_HUMAN	1-64	64	0	-	-
1.2b	ENST00000263915	2b	ENSE00001131409	chr2:165476329-165476197	133	GRB14_HUMAN	64-108	45	0	-	-
1.4	ENST00000263915	4	ENSE00001131400	chr2:165404326-165404170	157	GRB14_HUMAN	109-161	53	0	-	-
1.6	ENST00000263915	6	ENSE00000779610	chr2:165383645-165383524	122	GRB14_HUMAN	161-201	41	0	-	-
1.7b	ENST00000263915	7b	ENSE00000779609	chr2:165381588-165381514	75	GRB14_HUMAN	202-226	25	0	-	-
1.8	ENST00000263915	8	ENSE00000779608	chr2:165378627-165378490	138	GRB14_HUMAN	227-272	46	0	-	-
1.9a	ENST00000263915	9a	ENSE00000779606	chr2:165365362-165365252	111	GRB14_HUMAN	273-309	37	0	-	-
1.10b	ENST00000263915	10b	ENSE00000779604	chr2:165365060-165364965	96	GRB14_HUMAN	310-341	32	0	-	-
1.11a	ENST00000263915	11a	ENSE00001069027	chr2:165358845-165358765	81	GRB14_HUMAN	342-368	27	0	-	-
1.12a	ENST00000263915	12a	ENSE00000779602	chr2:165354000-165353884	117	GRB14_HUMAN	369-407	39	0	-	-
1.13	ENST00000263915	13	ENSE00000779601	chr2:165353793-165353721	73	GRB14_HUMAN	408-432	25	1	- B:430-432 (gaps)	- 17
1.14a	ENST00000263915	14a	ENSE00002158443	chr2:165353605-165353518	88	GRB14_HUMAN	432-461	30	2	A:433-461 B:432-461	29 30
1.15	ENST00000263915	15	ENSE00000779599	chr2:165351034-165350941	94	GRB14_HUMAN	461-492	32	2	A:461-492 B:461-492	32 32
1.16b	ENST00000263915	16b	ENSE00001902933	chr2:165349692-165349326	367	GRB14_HUMAN	493-540	48	2	A:493-537 B:493-537	45 45

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:105
 aligned with GRB14_HUMAN | Q14449 from UniProtKB/Swiss-Prot  Length:540

    Alignment length:105
                                   442       452       462       472       482       492       502       512       522       532     
          GRB14_HUMAN   433 IHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCAR 537
               SCOP domains d2auga_ A: automated matches                                                                              SCOP domains
               CATH domains 2augA00 A:433-537 SHC Adaptor Protein                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..ee...hhhhhhhhhhh......eeeeee.......eeeeeee..eeeeeeeeeeee..eeeee.........hhhhhhhhhh...........ee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------Y------------------------------ SAPs(SNPs)
                    PROSITE ------SH2  PDB: A:439-535 UniProt: 439-535                                                             -- PROSITE
           Transcript 1 (1) ----------------------------Exon 1.15  PDB: A:461-492       Exon 1.16b  PDB: A:493-537 UniProt: 493-540   Transcript 1 (1)
           Transcript 1 (2) Exon 1.14a  PDB: A:433-461   ---------------------------------------------------------------------------- Transcript 1 (2)
                 2aug A 433 IHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCAR 537
                                   442       452       462       472       482       492       502       512       522       532

Chain B from PDB  Type:PROTEIN  Length:108
 aligned with GRB14_HUMAN | Q14449 from UniProtKB/Swiss-Prot  Length:540

    Alignment length:122
                                   425       435       445       455       465       475       485       495       505       515       525       535  
          GRB14_HUMAN   416 THGSPTASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCAR 537
               SCOP domains d2              augb_ B: automated matches                                                                                 SCOP domains
               CATH domains 2a              ugB00 B:430-537 SHC Adaptor Protein                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..--------------hhhhhh..ee...hhhhhhhhhhhhh....eeeeee.......eeeeeee..eeeeeeeeeeee..eeeee.........hhhhhhhhhhhh.........ee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------Y------------------------------ SAPs(SNPs)
                    PROSITE -----------------------SH2  PDB: B:439-535 UniProt: 439-535                                                             -- PROSITE
           Transcript 1 (1) Exon 1.13        ----------------------------Exon 1.15  PDB: B:461-492       Exon 1.16b  PDB: B:493-537 UniProt: 493-540   Transcript 1 (1)
           Transcript 1 (2) ----------------Exon 1.14a  PDB: B:432-461    ---------------------------------------------------------------------------- Transcript 1 (2)
                 2aug B 430 SH--------------MIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQIIPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCAR 537
                             |       -      |435       445       455       465       475       485       495       505       515       525       535  
                           431            432

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: SH2-like (260)

Superfamily: SH2 domain (260)

Family: SH2 domain (225)

Protein domain: automated matches (15)

Human (Homo sapiens) [TaxId: 9606] (11)

1a	d2auga_	A:
1b	d2augb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: SHC Adaptor Protein (206)

Homologous Superfamily: SHC Adaptor Protein (206)

Human (Homo sapiens) (147)

1a	2augA00	A:433-537
1b	2augB00	B:430-537

(no "Pfam Domain" information available for 2AUG)

Asymmetric Unit(hide GO term definitions)

Chain A,B (GRB14_HUMAN | Q14449)

molecular function
	GO:0005070	SH3/SH2 adaptor activity	Interacting selectively and non-covalently and simultaneously with one or more signal transduction molecules, usually acting as a scaffold to bring these molecules into close proximity either using their own SH2/SH3 domains (e.g. Grb2) or those of their target molecules (e.g. SAM68).
biological process
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0009967	positive regulation of signal transduction	Any process that activates or increases the frequency, rate or extent of signal transduction.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0010008	endosome membrane	The lipid bilayer surrounding an endosome.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2aug)

	Sites
(no "Sites" information available for 2aug)

	Cis Peptide Bonds
		Asn A:471 - Pro A:472	[ RasMol ]
		Asn B:471 - Pro B:472	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2aug
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GRB14_HUMAN \| Q14449
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GRB14_HUMAN \| Q14449
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GRB14_HUMAN \| Q14449	:	2auh 4k81

(no "Related Entries Specified in the PDB File" available for 2AUG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (4, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File