Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE CATALYTIC AND CAM-BINDING DOMAINS OF INOSITOL 1,4,5-TRISPHOSPHATE 3-KINASE B
 
Authors :  P. P. Chamberlain, M. L. Sandberg, K. Sauer, M. P. Cooke, S. A. Lesley, G.
Date :  18 Aug 05  (Deposition) - 06 Dec 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ip3K, Itpkb, Ip3-3K, Ip3-3Kb, Inositol, Kinase, Ip3, Calmodulin Binding, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. P. Chamberlain, M. L. Sandberg, K. Sauer, M. P. Cooke, S. A. Lesley, G. Spraggon
Structural Insights Into Enzyme Regulation For Inositol 1, 4, 5-Trisphosphate 3-Kinase B
Biochemistry V. 44 14486 2005
PubMed-ID: 16262249  |  Reference-DOI: 10.1021/BI051256Q

(-) Compounds

Molecule 1
    Chains: A, B
    EC Number: 2.7.1.127
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: CAM-BINDING DOMAINS
    Organism Common: HOUSE MOUSE
    Organism Scientific: MUS MUSCULUS
    Organism Taxid: 10090

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 6)

Asymmetric/Biological Unit (2, 6)
No.NameCountTypeFull Name
1ATP2Ligand/IonADENOSINE-5'-TRIPHOSPHATE
2MG4Ligand/IonMAGNESIUM ION

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:105 , GLY A:874 , ASP A:893 , ATP A:1462BINDING SITE FOR RESIDUE MG A 600
2AC2SOFTWAREASP A:893 , LYS A:896 , ATP A:1462BINDING SITE FOR RESIDUE MG A 601
3AC3SOFTWARELYS B:741 , GLY B:874 , SER B:876 , ASP B:893 , ATP B:2462BINDING SITE FOR RESIDUE MG B 1600
4AC4SOFTWAREASP B:893 , ATP B:2462BINDING SITE FOR RESIDUE MG B 1601
5AC5SOFTWAREHOH A:2 , HOH A:6 , HOH A:8 , HOH A:21 , HOH A:105 , MG A:600 , MG A:601 , TRP A:666 , ILE A:667 , LEU A:669 , ALA A:670 , GLY A:671 , PHE A:676 , LYS A:686 , PRO A:709 , MET A:725 , ASP A:726 , ASP A:727 , LEU A:728 , ASP A:739 , LEU A:878 , ASP A:893 , LYS A:896BINDING SITE FOR RESIDUE ATP A 1462
6AC6SOFTWAREHOH B:53 , HOH B:79 , TRP B:666 , ILE B:667 , LEU B:669 , ALA B:670 , GLY B:671 , PHE B:676 , LYS B:686 , PRO B:709 , MET B:725 , ASP B:726 , ASP B:727 , LEU B:728 , ASP B:739 , LYS B:741 , ASP B:893 , MG B:1600 , MG B:1601BINDING SITE FOR RESIDUE ATP B 2462

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2AQX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2AQX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2AQX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2AQX)

(-) Exons   (6, 12)

Asymmetric/Biological Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000040321ENSRNOE00000438067chr13:96044260-96044554295IP3KB_RAT-00--
1.2ENSRNOT000000040322ENSRNOE00000028247chr13:96045892-960479862095IP3KB_RAT1-6326320--
1.3ENSRNOT000000040323ENSRNOE00000028409chr13:96128192-96128291100IP3KB_RAT633-666342A:650-674
B:651-674		25
24
1.4ENSRNOT000000040324ENSRNOE00000028438chr13:96129372-96129585214IP3KB_RAT666-737722A:674-745
B:674-745		72
72
1.5ENSRNOT000000040325ENSRNOE00000028465chr13:96133833-96134037205IP3KB_RAT737-805692A:745-813
B:745-813		69
69
1.6ENSRNOT000000040326ENSRNOE00000028493chr13:96136053-96136154102IP3KB_RAT806-839342A:814-847
B:814-847		34
34
1.7ENSRNOT000000040327ENSRNOE00000028526chr13:96137220-9613729172IP3KB_RAT840-863242A:848-871
B:848-871		24
24
1.8ENSRNOT000000040328ENSRNOE00000028555chr13:96137605-96138455851IP3KB_RAT864-934712A:872-938
B:872-937		67
66

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:289
 aligned with B2RXC2_MOUSE | B2RXC2 from UniProtKB/TrEMBL  Length:942

    Alignment length:289
                                   659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929         
         B2RXC2_MOUSE   650 MVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQG 938
               SCOP domains d2aqxa_ A: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeee..........eee....eeeee.hhhhhhhhhhhh...hhhhh..eeeeeee..eeeeeee.........eeeeeee.....hhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhh..hhhhhhhhhh...hhhhhheeeeeee.....ee.......hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.hhhhhheee...eeeeee.....eeeeee....eee....................hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2aqx A 650 MVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQG 938
                                   659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929         


Chain A from PDB  Type:PROTEIN  Length:289
 aligned with IP3KB_RAT | P42335 from UniProtKB/Swiss-Prot  Length:934

    Alignment length:289
                                   651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811       821       831       841       851       861       871       881       891       901       911       921         
            IP3KB_RAT   642 MVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQG 930
               SCOP domains d2aqxa_ A: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeee..........eee....eeeee.hhhhhhhhhhhh...hhhhh..eeeeeee..eeeeeee.........eeeeeee.....hhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhh..hhhhhhhhhh...hhhhhheeeeeee.....ee.......hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.hhhhhheee...eeeeee.....eeeeee....eee....................hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:650-674 ----------------------------------------------------------------------Exon 1.5  PDB: A:745-813 UniProt: 737-805                            Exon 1.6  PDB: A:814-847          Exon 1.7  PDB: A:848-871Exon 1.8  PDB: A:872-938 UniProt: 864-934 [INCOMPLETE]              Transcript 1 (1)
           Transcript 1 (2) ------------------------Exon 1.4  PDB: A:674-745 UniProt: 666-737                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2aqx A 650 MVQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQG 938
                                   659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       819       829       839       849       859       869       879       889       899       909       919       929         


Chain B from PDB  Type:PROTEIN  Length:287
 aligned with B2RXC2_MOUSE | B2RXC2 from UniProtKB/TrEMBL  Length:942

    Alignment length:287
                                   660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       
         B2RXC2_MOUSE   651 VQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQ 937
               SCOP domains d2aqxb_ B: automated matches                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeee..........eee....eeeee.hhhhhhhhhhhhh..hhhhh..eeeeeee..eeeeeee.........eeeeeee.....hhhhhhhhhhh...hhhhhhhhhhhh....hhhhhhhh..hhhhhhhhhh...hhhhhheeeeeee.....ee.......hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhh.eeee..eeeeee.....eeeeee...eeee....................hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2aqx B 651 VQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQ 937
                                   660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       


Chain B from PDB  Type:PROTEIN  Length:287
 aligned with IP3KB_RAT | P42335 from UniProtKB/Swiss-Prot  Length:934

    Alignment length:287
                                   652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       
            IP3KB_RAT   643 VQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRETLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLIDILTEMSQ 929
               SCOP domains d2aqxb_ B: automated matches                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeeee..........eee....eeeee.hhhhhhhhhhhhh..hhhhh..eeeeeee..eeeeeee.........eeeeeee.....hhhhhhhhhhh...hhhhhhhhhhhh....hhhhhhhh..hhhhhhhhhh...hhhhhheeeeeee.....ee.......hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhh.eeee..eeeeee.....eeeeee...eeee....................hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: B:651-674----------------------------------------------------------------------Exon 1.5  PDB: B:745-813 UniProt: 737-805                            Exon 1.6  PDB: B:814-847          Exon 1.7  PDB: B:848-871Exon 1.8  PDB: B:872-937 UniProt: 864-934 [INCOMPLETE]             Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.4  PDB: B:674-745 UniProt: 666-737                               ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2aqx B 651 VQWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMADVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGVRTYLEEELTKARKKPSLRKDMYQKMVEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGSVNRDFKKTKTREQVTEAFREFTKGNQNILIAYRDRLKAIRATLEISPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLDNLIDILTEMSQ 937
                                   660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2AQX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2AQX)

(-) Gene Ontology  (24, 46)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (IP3KB_RAT | P42335)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005516    calmodulin binding    Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
    GO:0008440    inositol-1,4,5-trisphosphate 3-kinase activity    Catalysis of the reaction: 1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + 2 H(+).
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0030217    T cell differentiation    The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071277    cellular response to calcium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0035726    common myeloid progenitor cell proliferation    The multiplication or reproduction of common myeloid progenitor cells, resulting in the expansion of a cell population. A common myeloid progenitor cell is a progenitor cell committed to the myeloid lineage.
    GO:0032957    inositol trisphosphate metabolic process    The chemical reactions and pathways involving myo-inositol phosphate, 1,2,3,4,5,6-cyclohexanehexol, with three phosphate groups attached.
    GO:0002262    myeloid cell homeostasis    The process of regulating the proliferation and elimination of myeloid cells such that the total number of myeloid cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
    GO:0045638    negative regulation of myeloid cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of myeloid cell differentiation.
    GO:0033030    negative regulation of neutrophil apoptotic process    Any process that stops, prevents, or reduces the frequency, rate, or extent of neutrophil apoptotic process.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0046579    positive regulation of Ras protein signal transduction    Any process that activates or increases the frequency, rate or extent of Ras protein signal transduction.
    GO:0046638    positive regulation of alpha-beta T cell differentiation    Any process that activates or increases the frequency, rate or extent of alpha-beta T cell differentiation.
    GO:0045059    positive thymic T cell selection    The process of sparing immature T cells in the thymus which react with self-MHC protein complexes with low affinity levels from apoptotic death.
    GO:0001932    regulation of protein phosphorylation    Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
    GO:0045061    thymic T cell selection    The process of T cell selection that occurs in the thymus.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B   (B2RXC2_MOUSE | B2RXC2)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0008440    inositol-1,4,5-trisphosphate 3-kinase activity    Catalysis of the reaction: 1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + 2 H(+).
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0030217    T cell differentiation    The process in which a precursor cell type acquires characteristics of a more mature T-cell. A T cell is a type of lymphocyte whose definin characteristic is the expression of a T cell receptor complex.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071277    cellular response to calcium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0035726    common myeloid progenitor cell proliferation    The multiplication or reproduction of common myeloid progenitor cells, resulting in the expansion of a cell population. A common myeloid progenitor cell is a progenitor cell committed to the myeloid lineage.
    GO:0032957    inositol trisphosphate metabolic process    The chemical reactions and pathways involving myo-inositol phosphate, 1,2,3,4,5,6-cyclohexanehexol, with three phosphate groups attached.
    GO:0002262    myeloid cell homeostasis    The process of regulating the proliferation and elimination of myeloid cells such that the total number of myeloid cells within a whole or part of an organism is stable over time in the absence of an outside stimulus.
    GO:0045638    negative regulation of myeloid cell differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of myeloid cell differentiation.
    GO:0033030    negative regulation of neutrophil apoptotic process    Any process that stops, prevents, or reduces the frequency, rate, or extent of neutrophil apoptotic process.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0046579    positive regulation of Ras protein signal transduction    Any process that activates or increases the frequency, rate or extent of Ras protein signal transduction.
    GO:0046638    positive regulation of alpha-beta T cell differentiation    Any process that activates or increases the frequency, rate or extent of alpha-beta T cell differentiation.
    GO:0045059    positive thymic T cell selection    The process of sparing immature T cells in the thymus which react with self-MHC protein complexes with low affinity levels from apoptotic death.
    GO:0001932    regulation of protein phosphorylation    Any process that modulates the frequency, rate or extent of addition of phosphate groups into an amino acid in a protein.
    GO:0045061    thymic T cell selection    The process of T cell selection that occurs in the thymus.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2aqx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2aqx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2RXC2_MOUSE | B2RXC2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  IP3KB_RAT | P42335
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.1.127
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B2RXC2_MOUSE | B2RXC2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IP3KB_RAT | P42335
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2AQX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2AQX)