2AMH - JenaLib

Title :   CRYSTAL STRUCTURE OF MAF-LIKE PROTEIN TBRU21784AAA FROM T.BRUCEI

Authors :   J. Caruthers, E. Merritt, Structural Genomics Of Pathogenic Prot Consortium (Sgpp)

Date :   09 Aug 05 (Deposition) - 16 Aug 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A

Keywords :   2 Domain Alpha-Beta Motif, Structural Genomics, Psi, Protein Structure Initiative, Structural Genomics Of Pathogenic Protozoa Consortium, Sgpp, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Caruthers, E. Merritt, Structural Genomics Of Pathogenic Protozoa Consortium (Sgpp
Crystal Structure Of Maf-Like Protein Tbru21784Aaa From T. Brucei
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (5, 5)

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:21 , GLU A:45 , LYS A:64 , PHE A:88 , ASP A:89 , GLN A:90 , GLU A:100 , LYS A:101 , SO4 A:401 , MN A:1001 , MN A:2001 , HOH A:3056 , HOH A:3080	BINDING SITE FOR RESIDUE SO4 A 400
2	AC2	SOFTWARE	THR A:16 , SER A:17 , ARG A:21 , PRO A:41 , GLU A:45 , LYS A:64 , SO4 A:400 , MN A:1001 , HOH A:3003 , HOH A:3064 , HOH A:3080	BINDING SITE FOR RESIDUE SO4 A 401
3	AC3	SOFTWARE	GLU A:45 , LYS A:64 , SO4 A:400 , SO4 A:401 , HOH A:3080 , HOH A:3086	BINDING SITE FOR RESIDUE MN A 1001
4	AC4	SOFTWARE	GLU A:45 , ASP A:89 , GLU A:100 , SO4 A:400 , HOH A:3087	BINDING SITE FOR RESIDUE MN A 2001
5	AC5	SOFTWARE	HIS A:140 , HOH A:3013 , HOH A:3081 , HOH A:3083 , HOH A:3084 , HOH A:3085	BINDING SITE FOR RESIDUE MN A 3001

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:195
                                                                                                                                                                                                                                   
               SCOP domains d2amha1 A:7-207 Maf homologue Tb11.01.5890                                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee...hhhhhhhhhhhhh....eeee.....hhhhh...hhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeee..eee....hhhhhhhhhhhhh..eeeeeeeeeeee.....eeeeeeeeeeee...hhhhhhhhhhhhhhhhhhhhh...hhhhhh.eeeee.hhhhhhh.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2amh A   7 EEIRTMIIGTSSAFRANVLREHFGDRFRNFVLLPPDIDEKAYRAADPFELTESIARAKMKAVLEKARQHPAIALTFDQVVVKGDEVREKPLSTEQCRSFIASYSGGGVRTVATYALCVVGTENVLVAHNETETFFSKFGDDIVERTLERGACMNSAGGLVVEDEDMSRHVVRIVGTSYGVRGMEPAVVEKLLSQL 207
                                    16        26        36        46        56        66        82        92       102       112       122       132       142       152       162       172       182       192       202     
                                                                                               75|                                                                                                                             
                                                                                                82

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2amh)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2amh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

Description