Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  RAJU
 
Authors :  M. D. Raju
Date :  08 Aug 05  (Deposition) - 23 Aug 05  (Release) - 23 Aug 05  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Calcium, Methylation, Repeat (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. D. Raju
Structure Prediction Of Glycoprotein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALMODULIN
    ChainsA
    Organism CommonTRYPANOSOMA
    Organism ScientificTRYPANOSOMA BRUCEI GAMBIENSE
    SynonymCAM

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ALS)

(-) Sites  (0, 0)

(no "Site" information available for 2ALS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ALS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ALS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Theoretical Model (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_CALM_TRYBG_001 *I101NCALM_TRYBG  ---  ---AI101N
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 8)

Theoretical Model (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.CALM_TRYBG8-43
44-79
81-116
117-149
  4A:8-43
A:44-79
A:81-116
A:117-149
2EF_HAND_1PS00018 EF-hand calcium-binding domain.CALM_TRYBG21-33
57-69
94-106
130-142
  4A:21-33
A:57-69
A:94-106
A:130-142

(-) Exons   (0, 0)

(no "Exon" information available for 2ALS)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:149
 aligned with CALM_TRYBG | P69098 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
           CALM_TRYBG     1 MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK 149
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhh...hhhhhhhhhhhh...hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------N------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -------EF_HAND_2  PDB: A:8-43 UniProt: 8-43EF_HAND_2  PDB: A:44-79             -EF_HAND_2  PDB: A:81-116            EF_HAND_2  PDB: A:117-149         PROSITE (1)
                PROSITE (2) --------------------EF_HAND_1    -----------------------EF_HAND_1    ------------------------EF_HAND_1    -----------------------EF_HAND_1    ------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2als A   1 MADQLSNEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDQDGSGTIDFPEFLTLMARKMQDSDSEEEIKEAFRVFDKDGNGFISAAELRHIMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKMMMSK 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ALS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ALS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ALS)

(-) Gene Ontology  (2, 2)

Theoretical Model(hide GO term definitions)
Chain A   (CALM_TRYBG | P69098)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2als)
 
  Sites
(no "Sites" information available for 2als)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2als)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2als
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM_TRYBG | P69098
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CALM_TRYBG | P69098
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ALS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ALS)