Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  INSILICO APPROACH FOR MODELING OF HYPOTHETICAL PROTEIN
 
Authors :  R. Vijayan
Date :  08 Aug 05  (Deposition) - 19 Sep 05  (Release) - 19 Sep 05  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Hypothetical Protein, Protein Folding, Heat Shock Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Vijayan
Insilico Approach For Modeling Of Hypothetical Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - BAG-FAMILY MOLECULAR CHAPERONE REGULATOR-5
    Chains: A
    Fragment: RESIDUES 356-450
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Synonym: BCL2-ASSOCIATED ATHANOGENE 5, BAG-5

 Structural Features

(-) Chains, Units

  
Theoretical Model : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ALO)

(-) Sites  (0, 0)

(no "Site" information available for 2ALO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ALO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ALO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ALO)

(-) PROSITE Motifs  (1, 1)

Theoretical Model (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BAGPS51035 BAG domain profile.BAG5_CHICK9-86
182-260
275-350
368-445		  1-
-
-
A:368-445

(-) Exons   (0, 0)

(no "Exon" information available for 2ALO)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
 aligned with BAG5_CHICK | Q5F486 from UniProtKB/Swiss-Prot  Length:450

    Alignment length:95
                                   365       375       385       395       405       415       425       435       445     
           BAG5_CHICK   356 QMYAEQTAAEHQSHKAVWTVLGNLSQIQQEVISFDGNKTDKNYMRLEELLTKQLLALDAVDPQGDERCKAARKQAVKLAQNILYYLDMKTDEWEY 450
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------BAG  PDB: A:368-445 UniProt: 368-445                                          ----- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                 2alo A 356 QMYAEQTAAEHQSHKAVWTVLGNLSQIQQEVISFDGNKTDKNYMRLEELLTKQLLALDAVDPQGDERCKAARKQAVKLAQNILYYLDMKTDEWEY 450
                                   365       375       385       395       405       415       425       435       445
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ALO)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ALO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ALO)

(-) Gene Ontology  (1, 1)

Theoretical Model(hide GO term definitions)
Chain A   (BAG5_CHICK | Q5F486)
molecular function
    GO:0051087    chaperone binding    Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2alo)
 
  Sites
(no "Sites" information available for 2alo)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2alo)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2alo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BAG5_CHICK | Q5F486
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BAG5_CHICK | Q5F486
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ALO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ALO)