|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 4)
Asymmetric Unit (1, 4)
|
Sites (0, 0)| (no "Site" information available for 2AB1) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2AB1) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (1, 2)
Asymmetric Unit (1, 2)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2AB1) |
Exons (3, 6)
Asymmetric Unit (3, 6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:122 aligned with AAMDC_HUMAN | Q9H7C9 from UniProtKB/Swiss-Prot Length:122 Alignment length:122 10 20 30 40 50 60 70 80 90 100 110 120 AAMDC_HUMAN 1 MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC 122 SCOP domains -d2ab1a1 A:2-122 Hypothetical protein PTD015 (C11orf67) SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------M------------------------------ SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.4 PDB: A:1-44 UniProt: 1-44 Exon 1.6 PDB: A:45-76 Exon 1.7d PDB: A:77-122 UniProt: 77-122 Transcript 1 2ab1 A 1 STSPEIASLSWGQmKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGmSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC 122 10 | 20 30 40 50 60 70| 80 90 100 110 120 14-MSE 71-MSE Chain B from PDB Type:PROTEIN Length:112 aligned with AAMDC_HUMAN | Q9H7C9 from UniProtKB/Swiss-Prot Length:122 Alignment length:122 10 20 30 40 50 60 70 80 90 100 110 120 AAMDC_HUMAN 1 MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC 122 SCOP domains d2ab1b_ B: Hypothetical protein PTD01 5 (C11orf67) SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------M------------------------------ SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.4 PDB: B:1-37 UniProt: 1-44 Exon 1.6 PDB: B:48-76 Exon 1.7d PDB: B:77-122 UniProt: 77-122 Transcript 1 2ab1 B 1 STSPEIASLSWGQmKVKGSNTTYKDCKVWPGGSRTWD----------GVQPADVKEVVEKGVQTLVIGRGmSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC 122 10 | 20 30 | - |50 60 70| 80 90 100 110 120 14-MSE 37 48 71-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2AB1) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2AB1) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (AAMDC_HUMAN | Q9H7C9)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|