Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ISOCHORISMATASE FAMILY PROTEIN
 
Authors :  C. Chang, C. Hatzos, F. Collart, S. Moy, A. Joachimiak, Midwest Center Structural Genomics (Mcsg)
Date :  01 Jul 05  (Deposition) - 16 Aug 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Chang, C. Hatzos, F. Collart, S. Moy, A. Joachimiak
Crystal Structure Of Isochorismatase Family Protein
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ISOCHORISMATASE FAMILY PROTEIN
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPMCSG
    Organism ScientificENTEROCOCCUS FAECALIS
    Organism Taxid226185
    StrainV583

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A  D
Biological Unit 2 (1x) BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2A67)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A67)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Ile A:15 -Glu A:16
2Val A:108 -Gln A:109
3Val B:108 -Gln B:109
4Val C:108 -Gln C:109
5Val D:108 -Gln D:109

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A67)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2A67)

(-) Exons   (0, 0)

(no "Exon" information available for 2A67)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:166
 aligned with Q82ZG7_ENTFA | Q82ZG7 from UniProtKB/TrEMBL  Length:166

    Alignment length:166
                             1                                                                                                                                                                    
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159      
         Q82ZG7_ENTFA     - -MKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRMAHGLGYTCLMTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLS 165
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2a67A00 A:0-165  [code=3.40.50.850, no name defined]                                                                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee..............hhhhhhhhhhhhhhhhhhh...eeeeee........................eeeee.........hhhhhhhhh...eeeeeee...hhhhhhhhhhhhhh.eeee....ee.......hhhhhhhhhhhhhh....ee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a67 A   0 AmKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRmAHGLGYTCLmTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLS 165
                             |       9        19        29        39        49        59        69        79        89        99       109       119|      129|      139       149       159      
                             |                                                                                                                    120-MSE   130-MSE                               
                             1-MSE                                                                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:167
 aligned with Q82ZG7_ENTFA | Q82ZG7 from UniProtKB/TrEMBL  Length:166

    Alignment length:167
                             1                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       
         Q82ZG7_ENTFA     - -MKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRMAHGLGYTCLMTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2a67B00 B:0-166  [code=3.40.50.850, no name defined]                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee..hhhhh.......hhhhhhhhhhhhhhhhhhh...eeeeee........................eeeee.........hhhhhhhhh...eeeeeee...hhhhhhhhhhhhhh.eeee....ee.......hhhhhhhhhhhhhh....ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a67 B   0 AmKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRmAHGLGYTCLmTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
                             |       9        19        29        39        49        59        69        79        89        99       109       119|      129|      139       149       159       
                             1-MSE                                                                                                                120-MSE   130-MSE                                

Chain C from PDB  Type:PROTEIN  Length:167
 aligned with Q82ZG7_ENTFA | Q82ZG7 from UniProtKB/TrEMBL  Length:166

    Alignment length:167
                             1                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       
         Q82ZG7_ENTFA     - -MKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRMAHGLGYTCLMTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2a67C00 C:0-166  [code=3.40.50.850, no name defined]                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee..hhhhh.......hhhhhhhhhhhhhhhhhhh...eeeeee........................eeeee.........hhhhhhhhh...eeeeeee...hhhhhhhhhhhhh..eeee....ee.......hhhhhhhhhhhhhh....ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a67 C   0 AmKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRmAHGLGYTCLmTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
                             |       9        19        29        39        49        59        69        79        89        99       109       119|      129|      139       149       159       
                             1-MSE                                                                                                                120-MSE   130-MSE                                

Chain D from PDB  Type:PROTEIN  Length:167
 aligned with Q82ZG7_ENTFA | Q82ZG7 from UniProtKB/TrEMBL  Length:166

    Alignment length:167
                             1                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       
         Q82ZG7_ENTFA     - -MKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRMAHGLGYTCLMTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2a67D00 D:0-166  [code=3.40.50.850, no name defined]                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeee..hhhhh.......hhhhhhhhhhhhhhhhhhh...eeeeee........................eeeee.........hhhhhhhhh...eeeeeee...hhhhhhhhhhhhhh.eeee....ee.......hhhhhhhhhhhhhh....ee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a67 D   0 AmKNRALLLIDFQKGIESPTQQLYRLPAVLDKVNQRIAVYRQHHAPIIFVQHEETELPFGSDSWQLFEKLDTQPTDFFIRKTHANAFYQTNLNDLLTEQAVQTLEIAGVQTEFCVDTTIRmAHGLGYTCLmTPKTTSTLDNGHLTAAQIIQHHEAIWAGRFLTFLSL 166
                             |       9        19        29        39        49        59        69        79        89        99       109       119|      129|      139       149       159       
                             1-MSE                                                                                                                120-MSE   130-MSE                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2A67)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A67)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q82ZG7_ENTFA | Q82ZG7)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2a67)
 
  Cis Peptide Bonds
    Ile A:15 - Glu A:16   [ RasMol ]  
    Val A:108 - Gln A:109   [ RasMol ]  
    Val B:108 - Gln B:109   [ RasMol ]  
    Val C:108 - Gln C:109   [ RasMol ]  
    Val D:108 - Gln D:109   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a67
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q82ZG7_ENTFA | Q82ZG7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q82ZG7_ENTFA | Q82ZG7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2A67)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A67)