Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF VACUOLAR PROTEIN SORTING 29 FROM CRYPTOSPORIDIUM PARVUM
 
Authors :  S. Brokx, Y. Zhao, Z. Alam, J. Lew, J. Weigelt, M. Sundstrom, C. Arrowsmith, A. Edwards, A. Bochkarev, R. Hui, J. R. Walker, Structural Genomics Consortium (Sgc)
Date :  21 Jun 05  (Deposition) - 16 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Vacuolar Protein Sorting Protein, Alpha-Beta-Beta-Alpha Sandwich, Structural Genomics, Structural Genomics Consortium, Sgc, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Vedadi, J. Lew, J. Artz, M. Amani, Y. Zhao, A. Dong, G. A. Wasney, M. Gao, T. Hills, S. Brokx, W. Qiu, S. Sharma, A. Diassiti, Z. Alam, M. Melone, A. Mulichak, A. Wernimont, J. Bray, P. Loppnau, O. Plotnikova, K. Newberry, E. Sundararajan, S. Houston, J. Walker, W. Tempel, A. Bochkarev, I. Kozieradzki, A. Edwards, C. Arrowsmith, D. Roos, K. Kain, R. Hui
Genome-Scale Protein Expression And Structural Biology Of Plasmodium Falciparum And Related Apicomplexan Organisms.
Mol. Biochem. Parasitol. V. 151 100 2007
PubMed-ID: 17125854  |  Reference-DOI: 10.1016/J.MOLBIOPARA.2006.10.011
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - VACUOLAR PROTEIN SORTING 29
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET28-LIC
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: CRYPTOSPORIDIUM PARVUM
    Organism Taxid: 5807
    Synonym: VESICLE PROTEIN SORTING 29, VPS29

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2A22)

(-) Sites  (0, 0)

(no "Site" information available for 2A22)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2A22)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Ile A:17 -Pro A:18
2Leu A:106 -Pro A:107
3Ile B:17 -Pro B:18
4Leu B:106 -Pro B:107

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2A22)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2A22)

(-) Exons   (0, 0)

(no "Exon" information available for 2A22)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:193
 aligned with Q5CYJ7_CRYPI | Q5CYJ7 from UniProtKB/TrEMBL  Length:197

    Alignment length:193
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194   
         Q5CYJ7_CRYPI     5 DFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 197
               SCOP domains d2a22a1 A:4-196 Vacuolar protein sorting 29, VPS29                                                                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee............hhhhhhhhhh....eeee.....hhhhhhhhhhhh..eee............hhhhh.....eeeeee..eeeeee.........hhhhhhhhhhhhh..eeee......eeeee..eeeee.................eeeeeeee..eeeeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a22 A   4 DFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 196
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193   


Chain B from PDB  Type:PROTEIN  Length:203
 aligned with Q5CYJ7_CRYPI | Q5CYJ7 from UniProtKB/TrEMBL  Length:197

    Alignment length:203
                                  1                                                                                                                                                                                                    
                                  |  4        14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194   
         Q5CYJ7_CRYPI     - ------MSSTDFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 197
               SCOP domains d2a22b_ B: Vacuolar protein sorting 29, VPS29                                                                                                                                                               SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeeeee............hhhhhhhhhh....eeee.....hhhhhhhhhh...eeee......................eeeeee..eeeeee.........hhhhhhhhhhhh...eeee......eeeee..eeeee.................eeeeeeee..eeeeeeeeee..eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2a22 B  -6 GLVPRGSSSTDFGDLVLLIGDLKIPYGAKELPSNFRELLATDKINYVLCTGNVCSQEYVEMLKNITKNVYIVSGDLDSAIFNPDPESNGVFPEYVVVQIGEFKIGLMHGNQVLPWDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNGKLFLNPGTATGAFSALTPDAPPSFMLMALQGNKVVLYVYDLRDGKTNVAMSEFSK 196
                                     3        13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2A22)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2A22)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2A22)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2a22)
 
  Sites
(no "Sites" information available for 2a22)
 
  Cis Peptide Bonds
    Ile A:17 - Pro A:18   [ RasMol ]  
    Ile B:17 - Pro B:18   [ RasMol ]  
    Leu A:106 - Pro A:107   [ RasMol ]  
    Leu B:106 - Pro B:107   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2a22
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5CYJ7_CRYPI | Q5CYJ7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5CYJ7_CRYPI | Q5CYJ7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2A22)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2A22)