2A1A - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   PKR KINASE DOMAIN-EIF2ALPHA COMPLEX

Authors :   A. C. Dar, T. E. Dever, F. Sicheri

Date :   19 Jun 05 (Deposition) - 27 Sep 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Transferase, Kinase, Protein Biosynthesis, Protein Synthesis- Transferase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. C. Dar, T. E. Dever, F. Sicheri
Higher-Order Substrate Recognition Of Eif2Alpha By The Rna-Dependent Protein Kinase Pkr.
Cell(Cambridge, Mass. ) V. 122 887 2005
PubMed-ID: 16179258 | Reference-DOI: 10.1016/J.CELL.2005.06.044

Molecule 1 - EUKARYOTIC TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PGEX-2T
	Expression System Strain	:	BL21 DE3 PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SUI2, TIF211
	Mutation	:	YES
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Synonym	:	EIF-2- ALPHA

Molecule 2 - INTERFERON-INDUCED, DOUBLE-STRANDED RNA-ACTIVATED PROTEIN KINASE
	Chains	:	B
	EC Number	:	2.7.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PET14B
	Expression System Strain	:	BL21 DE3 PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	PRKR, EIF2AK2, PKR
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	INTERFERON-INDUCIBLE RNA-DEPENDENT PROTEIN KINASE, P68 KINASE, P1/EIF-2A PROTEIN KINASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	TPO	1	Mod. Amino Acid	PHOSPHOTHREONINE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	TPO	2	Mod. Amino Acid	PHOSPHOTHREONINE

(no "Site" information available for 2A1A)

(no "SS Bond" information available for 2A1A)

(no "Cis Peptide Bond" information available for 2A1A)

Asymmetric Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_040474	V	428	E	E2AK2_HUMAN	Polymorphism	56219559	B	V	428	E
2	UniProt	VAR_040475	L	439	V	E2AK2_HUMAN	Unclassified	---	B	L	439	V
3	UniProt	VAR_040476	I	506	V	E2AK2_HUMAN	Polymorphism	34821155	B	I	506	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_040474	V	428	E	E2AK2_HUMAN	Polymorphism	56219559	B	V	428	E
2	UniProt	VAR_040475	L	439	V	E2AK2_HUMAN	Unclassified	---	B	L	439	V
3	UniProt	VAR_040476	I	506	V	E2AK2_HUMAN	Polymorphism	34821155	B	I	506	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	S1	PS50126	S1 domain profile.	IF2A_YEAST	17-88	1	A:16-87
2	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	E2AK2_HUMAN	273-296	1	B:273-296
3	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	E2AK2_HUMAN	410-422	1	B:410-422

Biological Unit 1 (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	S1	PS50126	S1 domain profile.	IF2A_YEAST	17-88	2	A:16-87
2	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	E2AK2_HUMAN	273-296	2	B:273-296
3	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	E2AK2_HUMAN	410-422	2	B:410-422

Asymmetric Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000395127	1b	ENSE00001479941	chr2:37384190-37384051	140	E2AK2_HUMAN	-	0	0	-	-
1.2a	ENST00000395127	2a	ENSE00001520686	chr2:37376400-37376000	401	E2AK2_HUMAN	-	0	0	-	-
1.3a	ENST00000395127	3a	ENSE00000809607	chr2:37374965-37374831	135	E2AK2_HUMAN	1-40	40	0	-	-
1.4a	ENST00000395127	4a	ENSE00000747498	chr2:37374116-37373996	121	E2AK2_HUMAN	40-80	41	0	-	-
1.5c	ENST00000395127	5c	ENSE00000747497	chr2:37368844-37368696	149	E2AK2_HUMAN	81-130	50	0	-	-
1.6	ENST00000395127	6	ENSE00000747496	chr2:37366900-37366774	127	E2AK2_HUMAN	130-172	43	0	-	-
1.7	ENST00000395127	7	ENSE00000747494	chr2:37365728-37365652	77	E2AK2_HUMAN	173-198	26	0	-	-
1.8	ENST00000395127	8	ENSE00000747492	chr2:37365506-37365413	94	E2AK2_HUMAN	198-229	32	0	-	-
1.9a	ENST00000395127	9a	ENSE00000747490	chr2:37364160-37364126	35	E2AK2_HUMAN	230-241	12	0	-	-
1.10	ENST00000395127	10	ENSE00000747488	chr2:37362689-37362627	63	E2AK2_HUMAN	241-262	22	1	B:255-262	8
1.11	ENST00000395127	11	ENSE00000747487	chr2:37353554-37353432	123	E2AK2_HUMAN	262-303	42	1	B:262-303	42
1.12	ENST00000395127	12	ENSE00000747486	chr2:37349807-37349649	159	E2AK2_HUMAN	303-356	54	1	B:303-356 (gaps)	54
1.13b	ENST00000395127	13b	ENSE00000397476	chr2:37347282-37347102	181	E2AK2_HUMAN	356-416	61	1	B:356-416	61
1.15	ENST00000395127	15	ENSE00000747412	chr2:37342002-37341874	129	E2AK2_HUMAN	417-459	43	1	B:417-459	43
1.16b	ENST00000395127	16b	ENSE00000747411	chr2:37336438-37336337	102	E2AK2_HUMAN	460-493	34	1	B:460-493	34
1.17	ENST00000395127	17	ENSE00000747410	chr2:37334670-37334617	54	E2AK2_HUMAN	494-511	18	1	B:494-511	18
1.18c	ENST00000395127	18c	ENSE00001520668	chr2:37334538-37333699	840	E2AK2_HUMAN	512-551	40	1	B:512-541	30

2.1	YJR007W	1	YJR007W.1	X:451012-451926	915	IF2A_YEAST	1-304	304	1	A:3-175 (gaps)	173

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:161
 aligned with IF2A_YEAST | P20459 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:173
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173   
           IF2A_YEAST     4 SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR 176
               SCOP domains d2a1aa1 A:3-88 automated matches                                                      d2a1aa2 A:89-175 automated matches                                                      SCOP domains
               CATH domains 2a1aA01 A:3-89 Nucleic acid-binding proteins                                           2a1aA02 A:90-175 Translation initiation factor 2; subunit 1; domain 2                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeeeee...eeeeee......eeeee..------------......eeeeeeeeee....eeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------S1  PDB: A:16-87 UniProt: 17-88                                         ---------------------------------------------------------------------------------------- PROSITE
               Transcript 2 Exon 2.1  PDB: A:3-175 (gaps) UniProt: 1-304 [INCOMPLETE]                                                                                                                     Transcript 2
                 2a1a A   3 SHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLS------------LIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISKR 175
                                    12        22        32        42     |   -        62        72        82        92       102       112       122       132       142       152       162       172   
                                                                        48           61

Chain B from PDB  Type:PROTEIN  Length:270
 aligned with E2AK2_HUMAN | P19525 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:287
                                   264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       
          E2AK2_HUMAN   255 TKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK 541
               SCOP domains d2a1ab_ B: automated matches                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2a1aB01 B:255-368 Phosphorylase Kinase; domain 1                                                                  2a1aB02 B:369-541 Transferase(Phosphotransferase) domain 1                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhheeeeeeeee...eeeeeeee.....eeeeeeee..hhhhhhhhhhhh.........eeeeeeeeee.....-----------------...eeeeeeeeee.....hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.eee...hhh.eeeee..eeee.....eee.................hhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------E----------V------------------------------------------------------------------V----------------------------------- SAPs(SNPs)
                    PROSITE ------------------PROTEIN_KINASE_ATP      -----------------------------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.10    ----------------------------------------Exon 1.12  PDB: B:303-356 (gaps) UniProt: 303-356     ------------------------------------------------------------Exon 1.15  PDB: B:417-459 UniProt: 417-459 Exon 1.16b  PDB: B:460-493        Exon 1.17         Exon 1.18c  PDB: B:512-541     Transcript 1 (1)
           Transcript 1 (2) -------Exon 1.11  PDB: B:262-303 UniProt: 262-303----------------------------------------------------Exon 1.13b  PDB: B:356-416 UniProt: 356-416                  ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2a1a B 255 GAHTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETS-----------------SRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRtRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKK 541
                                   264       274       284       294       304       314       324       334  |      -         -|      364       374       384       394       404       414       424       434       444 |     454       464       474       484       494       504       514       524       534       
                                                                                                            337               355                                                                                        446-TPO

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 2A1A)

Asymmetric Unit(hide GO term definitions)

Chain A (IF2A_YEAST | P20459)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0043022	ribosome binding	Interacting selectively and non-covalently with any part of a ribosome.
	GO:0003743	translation initiation factor activity	Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
	GO:0001731	formation of translation preinitiation complex	The joining of the small ribosomal subunit, ternary complex, and mRNA.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006413	translational initiation	The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
	GO:0033290	eukaryotic 48S preinitiation complex	A protein complex composed of the small ribosomal subunit, eIF3, eIF1A, methionyl-initiatior methionine and a capped mRNA. The complex is initially positioned at the 5'-end of the capped mRNA.
	GO:0005850	eukaryotic translation initiation factor 2 complex	Complex of three heterogeneous polypeptide chains, that form a ternary complex with initiator methionyl-tRNA and GTP. This ternary complex binds to free 40S subunit, which subsequently binds the 5' end of mRNA.
	GO:0005851	eukaryotic translation initiation factor 2B complex	A multisubunit guanine nucleotide exchange factor which catalyzes the exchange of GDP bound to initiation factor eIF2 for GTP, generating active eIF2-GTP. In humans, it is composed of five subunits, alpha, beta, delta, gamma and epsilon.
	GO:0043614	multi-eIF complex	A multifactor complex composed of multiple translation initiation factors and the initiatior tRNAiMet, which is ready to bind to the small (40S) ribosome to form the 43S preinitiation complex. In S. cerevisiae, this complex is composed of eIF1, eIF2, eIF3, and eIF5.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Chain B (E2AK2_HUMAN | P19525)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003725	double-stranded RNA binding	Interacting selectively and non-covalently with double-stranded RNA.
	GO:0004694	eukaryotic translation initiation factor 2alpha kinase activity	Catalysis of the reaction: ATP + [eukaryotic translation initiation factor 2 alpha subunit] = ADP + [eukaryotic translation initiation factor 2 alpha subunit] phosphate.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0004715	non-membrane spanning protein tyrosine kinase activity	Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0004713	protein tyrosine kinase activity	Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0000186	activation of MAPKK activity	The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
	GO:0034198	cellular response to amino acid starvation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of amino acids.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0030968	endoplasmic reticulum unfolded protein response	The series of molecular signals generated as a consequence of the presence of unfolded proteins in the endoplasmic reticulum (ER) or other ER-related stress; results in changes in the regulation of transcription and translation.
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0033689	negative regulation of osteoblast proliferation	Any process that stops, prevents or reduces the rate or extent of osteoblast proliferation.
	GO:0017148	negative regulation of translation	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.
	GO:0045071	negative regulation of viral genome replication	Any process that stops, prevents, or reduces the frequency, rate or extent of viral genome replication.
	GO:0018108	peptidyl-tyrosine phosphorylation	The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:1901224	positive regulation of NIK/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of NIK/NF-kappaB signaling.
	GO:0043065	positive regulation of apoptotic process	Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
	GO:0032722	positive regulation of chemokine production	Any process that activates or increases the frequency, rate, or extent of chemokine production.
	GO:0001819	positive regulation of cytokine production	Any process that activates or increases the frequency, rate or extent of production of a cytokine.
	GO:0032874	positive regulation of stress-activated MAPK cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the stress-activated MAPK cascade.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:1900225	regulation of NLRP3 inflammasome complex assembly	Any process that modulates the frequency, rate or extent of NLRP3 inflammasome complex assembly.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:1901532	regulation of hematopoietic progenitor cell differentiation	Any process that modulates the frequency, rate or extent of hematopoietic progenitor cell differentiation.
	GO:1902036	regulation of hematopoietic stem cell differentiation	Any process that modulates the frequency, rate or extent of hematopoietic stem cell differentiation.
	GO:1902033	regulation of hematopoietic stem cell proliferation	Any process that modulates the frequency, rate or extent of hematopoietic stem cell proliferation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0010998	regulation of translational initiation by eIF2 alpha phosphorylation	Any process that modulates the frequency, rate or extent of translation initiation in response to stress by the phosphorylation of eIF2 alpha.
	GO:0043330	response to exogenous dsRNA	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an exogenous double-stranded RNA stimulus.
	GO:0035455	response to interferon-alpha	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interferon-alpha stimulus. Interferon-alpha is a type I interferon.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0009612	response to mechanical stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mechanical stimulus.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0033197	response to vitamin E	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin E stimulus.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005840	ribosome	An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		TPO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2a1a)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2a1a)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2a1a
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	E2AK2_HUMAN \| P19525
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	IF2A_YEAST \| P20459
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	E2AK2_HUMAN \| P19525
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	IF2A_YEAST \| P20459
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	E2AK2_HUMAN \| P19525	:	1qu6 2a19 3uiu
	IF2A_YEAST \| P20459	:	1q46 2a19 3j81 3jap 3jaq

2a19	PKR-EIF2ALPHA-AMP-PNP COMPLEX.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (3, 3)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 3)

CATH Domains (4, 4)

Pfam Domains (0, 0)

Gene Ontology (67, 70)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File