Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF LIPL32, THE MOST ABUNDANT SURFACE PROTEIN OF PATHOGENIC LEPTOSPIRA SPP
 
Authors :  J. P. Vivian, T. Beddoe, J. Rossjohn
Date :  06 Feb 09  (Deposition) - 24 Feb 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.01
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Leptospira, Outer-Membrane Protein, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. P. Vivian, T. Beddoe, A. D. Mcalister, M. C. Wilce, L. Zaker-Tabrizi S. Troy, E. Byres, D. E. Hoke, P. A. Cullen, M. Lo, G. L. Murray, B. Adler, J. Rossjohn
Crystal Structure Of Lipl32, The Most Abundant Surface Protein Of Pathogenic Leptospira Spp.
J. Mol. Biol. V. 387 1229 2009
PubMed-ID: 19236879  |  Reference-DOI: 10.1016/J.JMB.2009.02.038

(-) Compounds

Molecule 1 - LIPL32 PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE30
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES IN DATABASE 21-261
    GeneLIPL32
    Organism ScientificLEPTOSPIRA INTERROGANS
    Organism Taxid173
    StrainLAI

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ZZ8)

(-) Sites  (0, 0)

(no "Site" information available for 2ZZ8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ZZ8)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:80 -Pro A:81
2Lys A:199 -Pro A:200
3Ser B:80 -Pro B:81
4Lys B:199 -Pro B:200

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ZZ8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ZZ8)

(-) Exons   (0, 0)

(no "Exon" information available for 2ZZ8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:230
 aligned with O34094_LEPIN | O34094 from UniProtKB/TrEMBL  Length:272

    Alignment length:237
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       
         O34094_LEPIN    25 GLPSLKSSFVLSEDTIPGTNETVKTLLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFDTWIRVERMSAIMPDQIAKAAKAKPVQKLDDDDDGDDTYKEERHNKYNSLTRIKIPNPPKSFDDLKNIDTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPPGIPGVSPLIHSNPEELQKQAIAAEE 261
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeee......eeeeeee..eeeeeeeee.......eee...eeeeeeeeee.....eeeeeee............eeehhhhhhhhhhhhhh......eeeeee....hhhhhhhhhhh....-------....eeee.......eeeee......hhhhhh..hhhhh...eeeeeeee........eeeeeeeeee..........eee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zz8 A   6 GLPSLKSSFVLSEDTIPGTNETVKTLLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFDTWIRVERMSAIMPDQIAKAAKAKPVQ-------GDDTYKEERHNKYNSLTRIKIPNPPKSFDDLKNIDTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPPGIPGVSPLIHSNPEELQKQAIAAEE 242
                                    15        25        35        45        55        65        75        85        95       105       115       125       135   |     - |     155       165       175       185       195       205       215       225       235       
                                                                                                                                                               139     147                                                                                               

Chain B from PDB  Type:PROTEIN  Length:230
 aligned with O34094_LEPIN | O34094 from UniProtKB/TrEMBL  Length:272

    Alignment length:237
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       
         O34094_LEPIN    25 GLPSLKSSFVLSEDTIPGTNETVKTLLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFDTWIRVERMSAIMPDQIAKAAKAKPVQKLDDDDDGDDTYKEERHNKYNSLTRIKIPNPPKSFDDLKNIDTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPPGIPGVSPLIHSNPEELQKQAIAAEE 261
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------Lipl32-2zz8B01 B:27-224                                                                                                                                                                               ------------------ Pfam domains (1)
           Pfam domains (2) ---------------------Lipl32-2zz8B02 B:27-224                                                                                                                                                                               ------------------ Pfam domains (2)
         Sec.struct. author .....eeeeeeeeee......eeeeeee..eeeeeeeee.......eee...eeeeeeeeee.....eeeeeee............eeehhhhhhhhhhhhhh......eeeeee....hhhhhhhhhhh....-------....eeee.......eeeee......hhhhhh..hhhhh...eeeeeeee........eeeeeeeeee..........eee.hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zz8 B   6 GLPSLKSSFVLSEDTIPGTNETVKTLLPYGSVINYYGYVKPGQAPDGLVDGNKKAYYLYVWIPAVIAEMGVRMISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFDTWIRVERMSAIMPDQIAKAAKAKPVQ-------GDDTYKEERHNKYNSLTRIKIPNPPKSFDDLKNIDTKKLLVRGLYRISFTTYKPGEVKGSFVASVGLLFPPGIPGVSPLIHSNPEELQKQAIAAEE 242
                                    15        25        35        45        55        65        75        85        95       105       115       125       135   |     - |     155       165       175       185       195       205       215       225       235       
                                                                                                                                                               139     147                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ZZ8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ZZ8)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2ZZ8)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2zz8)
 
  Sites
(no "Sites" information available for 2zz8)
 
  Cis Peptide Bonds
    Lys A:199 - Pro A:200   [ RasMol ]  
    Lys B:199 - Pro B:200   [ RasMol ]  
    Ser A:80 - Pro A:81   [ RasMol ]  
    Ser B:80 - Pro B:81   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2zz8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O34094_LEPIN | O34094
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  O34094_LEPIN | O34094
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ZZ8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ZZ8)